BLASTX nr result
ID: Lithospermum22_contig00020855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00020855 (495 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318005.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002318005.1| predicted protein [Populus trichocarpa] gi|222858678|gb|EEE96225.1| predicted protein [Populus trichocarpa] Length = 272 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 3 TGMMFGSQPPRECVQGSQPEWLHMQLGGSYEGA 101 TGM+FG QP R+ VQGSQPEWLHMQ+GGS++ A Sbjct: 239 TGMIFGPQPTRDYVQGSQPEWLHMQVGGSFKRA 271