BLASTX nr result
ID: Lithospermum22_contig00020852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00020852 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29559.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_003546981.1| PREDICTED: uncharacterized protein LOC100804... 59 4e-07 ref|XP_002534076.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_003542063.1| PREDICTED: uncharacterized protein LOC100811... 58 9e-07 >emb|CBI29559.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +2 Query: 278 MTFNREEKHWKCGKGGGLTLQRVSTIVRDIGDPCFHQSPIK 400 M++ +E+K W CGK + LQ+VS IVRDIG+PC HQSPIK Sbjct: 1 MSYEKEDKQWSCGKASSMNLQKVSAIVRDIGEPCLHQSPIK 41 >ref|XP_003546981.1| PREDICTED: uncharacterized protein LOC100804956 [Glycine max] Length = 699 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +2 Query: 278 MTFNREEKHWKCGKGGGLTLQRVSTIVRDIGDPCFHQSPIK 400 M EEK W CGK G L++VS+IVRDIGDPC QSP+K Sbjct: 1 MYCGEEEKQWTCGKAGAANLRKVSSIVRDIGDPCLSQSPVK 41 >ref|XP_002534076.1| conserved hypothetical protein [Ricinus communis] gi|223525888|gb|EEF28308.1| conserved hypothetical protein [Ricinus communis] Length = 662 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 293 EEKHWKCGKGGGLTLQRVSTIVRDIGDPCFHQSPIK 400 EEK W CGK G + LQRV +IVRDIG+PC QSPIK Sbjct: 7 EEKQWSCGKPGAVNLQRVGSIVRDIGEPCLAQSPIK 42 >ref|XP_003542063.1| PREDICTED: uncharacterized protein LOC100811679 [Glycine max] Length = 706 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +2 Query: 278 MTFNREEKHWKCGKGGGLTLQRVSTIVRDIGDPCFHQSPIK 400 M E K W CGK G + L++VS+IVRDIGDPC QSP+K Sbjct: 1 MYCGEEAKQWSCGKAGAVNLRKVSSIVRDIGDPCLSQSPVK 41