BLASTX nr result
ID: Lithospermum22_contig00020717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00020717 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515563.1| protein phosphatase 2a, regulatory subunit, ... 67 2e-09 >ref|XP_002515563.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus communis] gi|223545507|gb|EEF47012.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus communis] Length = 543 Score = 66.6 bits (161), Expect = 2e-09 Identities = 35/56 (62%), Positives = 39/56 (69%) Frame = +3 Query: 246 TMLKQILAKFPRKSSKTSPVDSVENNSCNNDANLGNGVPFTNSCTVLSNRLNVVKR 413 TMLKQIL+K PRKSSK+ DS S NN +N GNGVP TN S+RLNVVKR Sbjct: 40 TMLKQILSKIPRKSSKSESFDSAGIESGNNSSNWGNGVPCTNGGNSFSSRLNVVKR 95