BLASTX nr result
ID: Lithospermum22_contig00020189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00020189 (1049 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301522.1| predicted protein [Populus trichocarpa] gi|2... 64 8e-08 >ref|XP_002301522.1| predicted protein [Populus trichocarpa] gi|222843248|gb|EEE80795.1| predicted protein [Populus trichocarpa] Length = 138 Score = 63.5 bits (153), Expect = 8e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 723 PNCESRRMETLFQETADYIMALQMRVKVMQIMVNTLQGSDEEY 851 PN ES ++ LF+ETADYI++LQMRVKVMQIMV L GSD+EY Sbjct: 96 PNSESMGLDGLFRETADYILSLQMRVKVMQIMVKVLTGSDDEY 138