BLASTX nr result
ID: Lithospermum22_contig00019976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019976 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513844.1| Auxin response factor, putative [Ricinus com... 64 1e-08 ref|NP_001234237.1| auxin response factor 17 [Solanum lycopersic... 59 4e-07 ref|XP_003601137.1| Auxin response factor [Medicago truncatula] ... 58 7e-07 ref|XP_002527834.1| Auxin response factor, putative [Ricinus com... 58 9e-07 ref|XP_003522594.1| PREDICTED: uncharacterized protein LOC100793... 57 1e-06 >ref|XP_002513844.1| Auxin response factor, putative [Ricinus communis] gi|223546930|gb|EEF48427.1| Auxin response factor, putative [Ricinus communis] Length = 603 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 2/71 (2%) Frame = -2 Query: 370 VWRAATGPSVLVPTVGDRVYYFPQGHFEQCXXXXXGLSEAVLTS--LRRSFFHCRMVSVR 197 +WRA G SV +PT+ RVYYFPQGH EQ +S +L+S L + C++ +V+ Sbjct: 18 IWRACAGSSVQIPTINSRVYYFPQGHLEQSSNSSSIVSSCILSSIALSKPVIPCQISAVQ 77 Query: 196 LLFHPVTEQLF 164 L PVT++++ Sbjct: 78 FLADPVTDEVY 88 >ref|NP_001234237.1| auxin response factor 17 [Solanum lycopersicum] gi|313509556|gb|ADR66030.1| auxin response factor 17 [Solanum lycopersicum] Length = 622 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/69 (44%), Positives = 41/69 (59%) Frame = -2 Query: 370 VWRAATGPSVLVPTVGDRVYYFPQGHFEQCXXXXXGLSEAVLTSLRRSFFHCRMVSVRLL 191 VWRA G SV +P VG RVYYFPQGH E S AV++ +F CR++SVR L Sbjct: 15 VWRAIAGNSVKIPPVGTRVYYFPQGHAEHA----TFTSPAVMSPGMPAFILCRVLSVRFL 70 Query: 190 FHPVTEQLF 164 T++++ Sbjct: 71 AESDTDEVY 79 >ref|XP_003601137.1| Auxin response factor [Medicago truncatula] gi|355490185|gb|AES71388.1| Auxin response factor [Medicago truncatula] Length = 593 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/69 (40%), Positives = 40/69 (57%) Frame = -2 Query: 370 VWRAATGPSVLVPTVGDRVYYFPQGHFEQCXXXXXGLSEAVLTSLRRSFFHCRMVSVRLL 191 +WRA G +V +PTV RVYYFPQGH +Q LS +L+ R + C + +V L Sbjct: 20 LWRAIAGAAVQIPTVNSRVYYFPQGHMDQATSLPNNLSPLLLS---RPYILCSVSAVHFL 76 Query: 190 FHPVTEQLF 164 P T+++F Sbjct: 77 ADPKTDEVF 85 >ref|XP_002527834.1| Auxin response factor, putative [Ricinus communis] gi|223532758|gb|EEF34537.1| Auxin response factor, putative [Ricinus communis] Length = 620 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = -2 Query: 370 VWRAATGPSVLVPTVGDRVYYFPQGHFEQCXXXXXGLSEAVLTSLR-RSFFHCRMVSVRL 194 +W A GP V +P G+RVYYFPQGH EQ SE + SL S C++++V+ Sbjct: 49 LWDACAGPLVTLPREGERVYYFPQGHIEQLGAPIQQQSEHQMASLNLPSKILCKVINVQC 108 Query: 193 LFHPVTEQLF 164 P+T+Q++ Sbjct: 109 KAEPITDQVY 118 >ref|XP_003522594.1| PREDICTED: uncharacterized protein LOC100793208 [Glycine max] Length = 1160 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/70 (40%), Positives = 42/70 (60%) Frame = -2 Query: 373 AVWRAATGPSVLVPTVGDRVYYFPQGHFEQCXXXXXGLSEAVLTSLRRSFFHCRMVSVRL 194 A+W G +V +PT+ RVYYFPQGHF+Q LS +L+ + CR+ SV+ Sbjct: 19 ALWLVCAGTTVEIPTLHSRVYYFPQGHFDQASSAPRNLSPLLLS---KPAVLCRVESVQF 75 Query: 193 LFHPVTEQLF 164 L P+T+++F Sbjct: 76 LADPLTDEVF 85