BLASTX nr result
ID: Lithospermum22_contig00019941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019941 (516 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156583.1| PREDICTED: PRA1 family protein A1-like [Cucu... 117 7e-25 ref|XP_003552205.1| PREDICTED: PRA1 family protein A1-like [Glyc... 117 7e-25 gb|ACU24194.1| unknown [Glycine max] 117 7e-25 ref|NP_001237681.1| uncharacterized protein LOC100527037 [Glycin... 117 7e-25 ref|XP_002273794.1| PREDICTED: PRA1 family protein A2 isoform 1 ... 117 1e-24 >ref|XP_004156583.1| PREDICTED: PRA1 family protein A1-like [Cucumis sativus] Length = 209 Score = 117 bits (294), Expect = 7e-25 Identities = 53/66 (80%), Positives = 60/66 (90%) Frame = -3 Query: 514 LFVLIFSTVSFFLWFVSCGLLTVSWAFLFGLLATLIHASFRTPNLKARLNTFREEFRAVW 335 +FVL+FS+VSF WF+SCGLLTV W+ FGLLATL+HASFRTPNLK RLNTFREEFRAVW Sbjct: 144 VFVLVFSSVSFLFWFISCGLLTVLWSLSFGLLATLLHASFRTPNLKPRLNTFREEFRAVW 203 Query: 334 RNYSDL 317 RNYS+L Sbjct: 204 RNYSEL 209 >ref|XP_003552205.1| PREDICTED: PRA1 family protein A1-like [Glycine max] Length = 209 Score = 117 bits (294), Expect = 7e-25 Identities = 55/66 (83%), Positives = 60/66 (90%) Frame = -3 Query: 514 LFVLIFSTVSFFLWFVSCGLLTVSWAFLFGLLATLIHASFRTPNLKARLNTFREEFRAVW 335 +FVLIFS+ SFFLWFVS GLLTV WA GLLAT++HASFRTPNLKARLNTFREEFRAVW Sbjct: 144 VFVLIFSSASFFLWFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVW 203 Query: 334 RNYSDL 317 RNYS+L Sbjct: 204 RNYSEL 209 >gb|ACU24194.1| unknown [Glycine max] Length = 167 Score = 117 bits (294), Expect = 7e-25 Identities = 55/66 (83%), Positives = 60/66 (90%) Frame = -3 Query: 514 LFVLIFSTVSFFLWFVSCGLLTVSWAFLFGLLATLIHASFRTPNLKARLNTFREEFRAVW 335 +FVLIFS+ SFFLWFVS GLLTV WA GLLAT++HASFRTPNLKARLNTFREEFRAVW Sbjct: 102 VFVLIFSSASFFLWFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVW 161 Query: 334 RNYSDL 317 RNYS+L Sbjct: 162 RNYSEL 167 >ref|NP_001237681.1| uncharacterized protein LOC100527037 [Glycine max] gi|255631416|gb|ACU16075.1| unknown [Glycine max] Length = 209 Score = 117 bits (294), Expect = 7e-25 Identities = 55/66 (83%), Positives = 60/66 (90%) Frame = -3 Query: 514 LFVLIFSTVSFFLWFVSCGLLTVSWAFLFGLLATLIHASFRTPNLKARLNTFREEFRAVW 335 +FVLIFS+ SFFLWFVS GLLTV WA GLLAT++HASFRTPNLKARLNTFREEFRAVW Sbjct: 144 VFVLIFSSASFFLWFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVW 203 Query: 334 RNYSDL 317 RNYS+L Sbjct: 204 RNYSEL 209 >ref|XP_002273794.1| PREDICTED: PRA1 family protein A2 isoform 1 [Vitis vinifera] gi|359481732|ref|XP_003632665.1| PREDICTED: PRA1 family protein A2 isoform 2 [Vitis vinifera] gi|297740305|emb|CBI30487.3| unnamed protein product [Vitis vinifera] Length = 209 Score = 117 bits (293), Expect = 1e-24 Identities = 54/66 (81%), Positives = 60/66 (90%) Frame = -3 Query: 514 LFVLIFSTVSFFLWFVSCGLLTVSWAFLFGLLATLIHASFRTPNLKARLNTFREEFRAVW 335 +FVLIFS+VSF LWFVSC +LTV WA GLLAT++HASFRTPNLKARLNTFREEFRAVW Sbjct: 144 VFVLIFSSVSFILWFVSCSILTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVW 203 Query: 334 RNYSDL 317 RNYS+L Sbjct: 204 RNYSEL 209