BLASTX nr result
ID: Lithospermum22_contig00019860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019860 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275990.1| PREDICTED: cysteine synthase isoform 2 [Viti... 57 2e-06 ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|3... 57 2e-06 ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|2... 57 2e-06 emb|CAJ32462.1| putative cytosolic cysteine synthase 7 [Nicotian... 56 3e-06 ref|NP_001242884.1| uncharacterized protein LOC100775420 [Glycin... 56 3e-06 >ref|XP_002275990.1| PREDICTED: cysteine synthase isoform 2 [Vitis vinifera] gi|225451237|ref|XP_002275940.1| PREDICTED: cysteine synthase isoform 1 [Vitis vinifera] gi|359487829|ref|XP_003633658.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|147819267|emb|CAN75607.1| hypothetical protein VITISV_033255 [Vitis vinifera] gi|298204909|emb|CBI34216.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 311 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 219 VV+FPSFGERYLSS LFDSV++EAENM F+P Sbjct: 295 VVVFPSFGERYLSSVLFDSVKREAENMLFEP 325 >ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|355512059|gb|AES93682.1| Cysteine synthase [Medicago truncatula] Length = 284 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 311 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 219 VV+FPSFGERYLSS LF+SVR+EAE MTF+P Sbjct: 254 VVVFPSFGERYLSSVLFESVRREAETMTFEP 284 >ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|217074042|gb|ACJ85381.1| unknown [Medicago truncatula] gi|355512058|gb|AES93681.1| Cysteine synthase [Medicago truncatula] Length = 325 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 311 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 219 VV+FPSFGERYLSS LF+SVR+EAE MTF+P Sbjct: 295 VVVFPSFGERYLSSVLFESVRREAETMTFEP 325 >emb|CAJ32462.1| putative cytosolic cysteine synthase 7 [Nicotiana tabacum] Length = 325 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 311 VVIFPSFGERYLSSALFDSVRKEAENMTFDP 219 VV+FPSFGERYLSS LF+SVR+EAENMT +P Sbjct: 295 VVVFPSFGERYLSSVLFESVRREAENMTVEP 325 >ref|NP_001242884.1| uncharacterized protein LOC100775420 [Glycine max] gi|255645072|gb|ACU23035.1| unknown [Glycine max] Length = 324 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 311 VVIFPSFGERYLSSALFDSVRKEAENMTFD 222 VVIFPSFGERYLSS LF+S+RKEAE MTFD Sbjct: 295 VVIFPSFGERYLSSPLFESIRKEAEQMTFD 324