BLASTX nr result
ID: Lithospermum22_contig00019844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019844 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA86386.1| transcription factor [Nicotiana tabacum] 74 1e-11 ref|XP_002530154.1| E2F4,5, putative [Ricinus communis] gi|22353... 70 2e-10 emb|CAC17702.1| transcription factor (E2F) [Chenopodium rubrum] 70 2e-10 emb|CBI28269.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002272473.1| PREDICTED: transcription factor E2FB-like [V... 67 2e-09 >dbj|BAA86386.1| transcription factor [Nicotiana tabacum] Length = 439 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/60 (56%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = +1 Query: 1 DADYWLLSDADVSVTDLW-TDSVFNWNDLGIINEGCPLPCISTPQRVGTPPSNTTEMPGS 177 + DYWLLSDADVS+TD+W DSV +WN+L +I+E + +STP R TPPS+TTE+P + Sbjct: 376 EEDYWLLSDADVSITDIWRADSVLDWNELNVIHEDYSIANVSTP-RAQTPPSSTTELPSA 434 >ref|XP_002530154.1| E2F4,5, putative [Ricinus communis] gi|223530315|gb|EEF32209.1| E2F4,5, putative [Ricinus communis] Length = 451 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/62 (53%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = +1 Query: 1 DADYWLLSDADVSVTDLW-TDSVFNWNDLGIINEGCPLPCISTPQRVGTPPSNTTEMPGS 177 DADYWLLSDADVS+TD+W TD+ WND+ ++ +P + TP R TPPS E+P Sbjct: 387 DADYWLLSDADVSITDMWRTDANVEWNDVNMLRADFGIPDVQTP-RAQTPPSGMAEVPTG 445 Query: 178 VN 183 VN Sbjct: 446 VN 447 >emb|CAC17702.1| transcription factor (E2F) [Chenopodium rubrum] Length = 454 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/58 (56%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +1 Query: 1 DADYWLLSDADVSVTDLW-TDSVFNWNDLGIINEGCPLPCISTPQRVGTPPSNTTEMP 171 DADYWLLSDADVS+TD+W TDS WN+LG I+E + + TPQ PPS T +P Sbjct: 391 DADYWLLSDADVSITDMWRTDSGVEWNELGTIHEDYTVANVGTPQPQSPPPSATEVLP 448 >emb|CBI28269.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +1 Query: 1 DADYWLLSDADVSVTDLW-TDSVFNWNDLGIINEGCPLPCISTPQRVGTPPSNTTEMPGS 177 DADYWLLSDADVS+TD+W T+ WN+L +N+ + +STPQ TPPS+ E+P + Sbjct: 382 DADYWLLSDADVSITDMWRTEPGVEWNELDALNDDYAMANVSTPQ-PQTPPSSAAEVPPA 440 Query: 178 VN 183 N Sbjct: 441 AN 442 >ref|XP_002272473.1| PREDICTED: transcription factor E2FB-like [Vitis vinifera] Length = 457 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +1 Query: 1 DADYWLLSDADVSVTDLW-TDSVFNWNDLGIINEGCPLPCISTPQRVGTPPSNTTEMPGS 177 DADYWLLSDADVS+TD+W T+ WN+L +N+ + +STPQ TPPS+ E+P + Sbjct: 393 DADYWLLSDADVSITDMWRTEPGVEWNELDALNDDYAMANVSTPQ-PQTPPSSAAEVPPA 451 Query: 178 VN 183 N Sbjct: 452 AN 453