BLASTX nr result
ID: Lithospermum22_contig00019707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019707 (465 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632627.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 94 6e-19 gb|AEW24433.1| ubiquitin-conjugating enzyme E2 [Camellia sinensis] 94 6e-19 ref|XP_002284203.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 94 6e-19 ref|XP_002274367.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 94 6e-19 ref|NP_001234247.1| ubiquitin-conjugating enzyme E2-17 kDa [Sola... 94 6e-19 >ref|XP_003632627.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Vitis vinifera] Length = 155 Score = 94.4 bits (233), Expect(2) = 6e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 2 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 130 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY Sbjct: 110 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 152 Score = 24.6 bits (52), Expect(2) = 6e-19 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 213 SWTQKYAMG 239 SWTQKYAMG Sbjct: 147 SWTQKYAMG 155 >gb|AEW24433.1| ubiquitin-conjugating enzyme E2 [Camellia sinensis] Length = 148 Score = 94.4 bits (233), Expect(2) = 6e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 2 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 130 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 145 Score = 24.6 bits (52), Expect(2) = 6e-19 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 213 SWTQKYAMG 239 SWTQKYAMG Sbjct: 140 SWTQKYAMG 148 >ref|XP_002284203.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 2 [Vitis vinifera] gi|225440290|ref|XP_002284197.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 1 [Vitis vinifera] gi|359489699|ref|XP_003633968.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Vitis vinifera] gi|147803053|emb|CAN77754.1| hypothetical protein VITISV_039341 [Vitis vinifera] gi|147852846|emb|CAN81281.1| hypothetical protein VITISV_016558 [Vitis vinifera] gi|297741756|emb|CBI32888.3| unnamed protein product [Vitis vinifera] gi|297745391|emb|CBI40471.3| unnamed protein product [Vitis vinifera] Length = 148 Score = 94.4 bits (233), Expect(2) = 6e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 2 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 130 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 145 Score = 24.6 bits (52), Expect(2) = 6e-19 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 213 SWTQKYAMG 239 SWTQKYAMG Sbjct: 140 SWTQKYAMG 148 >ref|XP_002274367.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 2 [Vitis vinifera] gi|225462033|ref|XP_002274335.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform 1 [Vitis vinifera] gi|359494225|ref|XP_003634740.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Vitis vinifera] gi|147771931|emb|CAN77946.1| hypothetical protein VITISV_029275 [Vitis vinifera] gi|296089984|emb|CBI39803.3| unnamed protein product [Vitis vinifera] Length = 148 Score = 94.4 bits (233), Expect(2) = 6e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 2 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 130 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 145 Score = 24.6 bits (52), Expect(2) = 6e-19 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 213 SWTQKYAMG 239 SWTQKYAMG Sbjct: 140 SWTQKYAMG 148 >ref|NP_001234247.1| ubiquitin-conjugating enzyme E2-17 kDa [Solanum lycopersicum] gi|464981|sp|P35135.1|UBC4_SOLLC RecName: Full=Ubiquitin-conjugating enzyme E2-17 kDa; AltName: Full=Ubiquitin carrier protein; AltName: Full=Ubiquitin-protein ligase gi|388207|gb|AAA34125.1| ubiquitin carrier protein [Solanum lycopersicum] gi|83283973|gb|ABC01894.1| ubiquitin-conjugating enzyme E2-like protein [Solanum tuberosum] gi|213494485|gb|ACJ48964.1| ubiquitin conjugating enzyme [Solanum lycopersicum] Length = 148 Score = 94.4 bits (233), Expect(2) = 6e-19 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 2 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 130 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY Sbjct: 103 LLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 145 Score = 24.6 bits (52), Expect(2) = 6e-19 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 213 SWTQKYAMG 239 SWTQKYAMG Sbjct: 140 SWTQKYAMG 148