BLASTX nr result
ID: Lithospermum22_contig00019664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019664 (612 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510245.1| conserved hypothetical protein [Ricinus comm... 65 9e-09 ref|XP_002327130.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_002301192.1| predicted protein [Populus trichocarpa] gi|2... 64 3e-08 ref|XP_002284610.1| PREDICTED: uncharacterized protein LOC100248... 61 2e-07 emb|CAN63228.1| hypothetical protein VITISV_002667 [Vitis vinifera] 61 2e-07 >ref|XP_002510245.1| conserved hypothetical protein [Ricinus communis] gi|223550946|gb|EEF52432.1| conserved hypothetical protein [Ricinus communis] Length = 321 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 1 PKLNFKDSYSESYRNAHPNAPLVVPWVAGLVS 96 P+LNFKD YSESYRN+HPNAPLVVPWV+G+VS Sbjct: 289 PRLNFKDKYSESYRNSHPNAPLVVPWVSGVVS 320 >ref|XP_002327130.1| predicted protein [Populus trichocarpa] gi|222835445|gb|EEE73880.1| predicted protein [Populus trichocarpa] Length = 321 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 PKLNFKDSYSESYRNAHPNAPLVVPWVAGLVS 96 PKLNFKD YSESYR++HPNAPL+VPWV+G+VS Sbjct: 289 PKLNFKDKYSESYRDSHPNAPLIVPWVSGVVS 320 >ref|XP_002301192.1| predicted protein [Populus trichocarpa] gi|222842918|gb|EEE80465.1| predicted protein [Populus trichocarpa] Length = 321 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 PKLNFKDSYSESYRNAHPNAPLVVPWVAGLVS 96 PKLNFKD YSESYR++HPNAPL+VPWV+G+VS Sbjct: 289 PKLNFKDRYSESYRDSHPNAPLIVPWVSGVVS 320 >ref|XP_002284610.1| PREDICTED: uncharacterized protein LOC100248838 [Vitis vinifera] gi|302142335|emb|CBI19538.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 PKLNFKDSYSESYRNAHPNAPLVVPWVAGLVS 96 P+LNFKD YSESYRNAHP+APL VPWV+G+ S Sbjct: 289 PRLNFKDKYSESYRNAHPSAPLFVPWVSGVAS 320 >emb|CAN63228.1| hypothetical protein VITISV_002667 [Vitis vinifera] Length = 340 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 PKLNFKDSYSESYRNAHPNAPLVVPWVAGLV 93 P+LNFKD YSESYRNAHP+APL VPWV+G+V Sbjct: 178 PRLNFKDKYSESYRNAHPSAPLFVPWVSGVV 208