BLASTX nr result
ID: Lithospermum22_contig00019520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019520 (718 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein ... 130 3e-28 ref|XP_003556095.1| PREDICTED: DUF246 domain-containing protein ... 129 5e-28 ref|XP_002526030.1| conserved hypothetical protein [Ricinus comm... 127 2e-27 ref|XP_002315879.1| predicted protein [Populus trichocarpa] gi|2... 127 3e-27 ref|XP_003529417.1| PREDICTED: DUF246 domain-containing protein ... 125 1e-26 >ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein At1g04910 [Vitis vinifera] gi|297737694|emb|CBI26895.3| unnamed protein product [Vitis vinifera] Length = 561 Score = 130 bits (327), Expect = 3e-28 Identities = 57/69 (82%), Positives = 67/69 (97%) Frame = -3 Query: 716 IKPDKRKLALLFDNPNIGWKSFKRQMLSMRAHSASKGFELKRPSDSIYSFPCPDCMCRVK 537 ++PDKRKLALLFDNPNIGWKSFKRQML+MRAHS +KGFELKRP+DSIY+FPCPDCMCR+ Sbjct: 491 VRPDKRKLALLFDNPNIGWKSFKRQMLNMRAHSDAKGFELKRPNDSIYTFPCPDCMCRMN 550 Query: 536 KTDESRSSS 510 K+++SRSSS Sbjct: 551 KSEDSRSSS 559 >ref|XP_003556095.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 564 Score = 129 bits (325), Expect = 5e-28 Identities = 59/69 (85%), Positives = 64/69 (92%) Frame = -3 Query: 716 IKPDKRKLALLFDNPNIGWKSFKRQMLSMRAHSASKGFELKRPSDSIYSFPCPDCMCRVK 537 IKPDKRKLALLFDNPNIGWKS KRQ+LSMR+HS SKG ELKRP+DSIYSFPCPDCMCR Sbjct: 494 IKPDKRKLALLFDNPNIGWKSLKRQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMCRAN 553 Query: 536 KTDESRSSS 510 +TD+SRSSS Sbjct: 554 RTDDSRSSS 562 >ref|XP_002526030.1| conserved hypothetical protein [Ricinus communis] gi|223534677|gb|EEF36370.1| conserved hypothetical protein [Ricinus communis] Length = 570 Score = 127 bits (319), Expect = 2e-27 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = -3 Query: 716 IKPDKRKLALLFDNPNIGWKSFKRQMLSMRAHSASKGFELKRPSDSIYSFPCPDCMCRVK 537 I+PDKRKLALLFDNPN+GWKSFKR ML+MR+HS SKGFELKRP+DSIYSFPCPDCMCR+ Sbjct: 502 IRPDKRKLALLFDNPNLGWKSFKRHMLNMRSHSDSKGFELKRPNDSIYSFPCPDCMCRMN 561 Query: 536 KTDESRSSST 507 KT ESRSS+T Sbjct: 562 KT-ESRSSAT 570 >ref|XP_002315879.1| predicted protein [Populus trichocarpa] gi|222864919|gb|EEF02050.1| predicted protein [Populus trichocarpa] Length = 569 Score = 127 bits (318), Expect = 3e-27 Identities = 55/69 (79%), Positives = 65/69 (94%) Frame = -3 Query: 716 IKPDKRKLALLFDNPNIGWKSFKRQMLSMRAHSASKGFELKRPSDSIYSFPCPDCMCRVK 537 I+PDKRKLALLFDNP IGWKSFKR M++MR+HS SKGFELKRP+DS+YS+PCPDCMCRV Sbjct: 499 IRPDKRKLALLFDNPKIGWKSFKRHMMNMRSHSDSKGFELKRPNDSVYSYPCPDCMCRVN 558 Query: 536 KTDESRSSS 510 +T++SRSSS Sbjct: 559 RTEDSRSSS 567 >ref|XP_003529417.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 564 Score = 125 bits (313), Expect = 1e-26 Identities = 57/68 (83%), Positives = 62/68 (91%) Frame = -3 Query: 716 IKPDKRKLALLFDNPNIGWKSFKRQMLSMRAHSASKGFELKRPSDSIYSFPCPDCMCRVK 537 IKPDKRKLALLFDNPNIGWKS KRQ+LSMR+HS SKG ELKRP+DSIYSFPCPDCMCR Sbjct: 494 IKPDKRKLALLFDNPNIGWKSLKRQLLSMRSHSDSKGVELKRPNDSIYSFPCPDCMCRSN 553 Query: 536 KTDESRSS 513 +TD+ RSS Sbjct: 554 RTDDLRSS 561