BLASTX nr result
ID: Lithospermum22_contig00019457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019457 (1046 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD32950.1| putative non-LTR retroelement reverse transcripta... 57 6e-06 >gb|AAD32950.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 773 Score = 57.4 bits (137), Expect = 6e-06 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 6/107 (5%) Frame = -3 Query: 369 FRRLRDMTSKDHTSGSSMNLV--QNGLGQIWKVNLPGKIKHFLWRVSQNTLSAIDNLRRS 196 + LR ++ + H S S N V Q IWK N P KIKHF WR + N L NL+R Sbjct: 472 YHLLRKLSQQQHASLPSPNEVSAQTVFTNIWKQNAPPKIKHFWWRSAHNALPTAGNLKRR 531 Query: 195 KVLISPECKLCRGLDKKVN---YTCLMNAHIYKRFVELLVCHI-ICP 67 +++ C+ C + VN + C ++ I+++ HI +CP Sbjct: 532 RLITDDTCQRCGEASEDVNHLLFQCRVSKEIWEQ------AHIKLCP 572