BLASTX nr result
ID: Lithospermum22_contig00019299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019299 (611 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P13869.1|CB12_PETHY RecName: Full=Chlorophyll a-b binding pro... 58 1e-06 >sp|P13869.1|CB12_PETHY RecName: Full=Chlorophyll a-b binding protein, chloroplastic; AltName: Full=LHCI type II CAB; Flags: Precursor gi|169214|gb|AAA33711.1| chlorophyll binding protein precursor [Petunia x hybrida] gi|226259|prf||1503272A chlorophyll binding protein Length = 270 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 519 FSSPNSQKNVPIVAATKKSFIGGSQLKVSKFSAPSGRRSVTVWA 388 FSSP+SQKN IV ATK SF+GG +L+VSKF AP G RSV V A Sbjct: 15 FSSPSSQKNGSIVGATKASFLGGKRLRVSKFIAPVGSRSVAVSA 58