BLASTX nr result
ID: Lithospermum22_contig00019043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00019043 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512911.1| Protein C14orf111, putative [Ricinus communi... 92 4e-17 ref|XP_002512860.1| Protein C14orf111, putative [Ricinus communi... 92 4e-17 ref|XP_004136642.1| PREDICTED: rRNA-processing protein FCF1 homo... 89 5e-16 ref|XP_003540279.1| PREDICTED: rRNA-processing protein FCF1 homo... 88 6e-16 gb|ACU19577.1| unknown [Glycine max] 88 6e-16 >ref|XP_002512911.1| Protein C14orf111, putative [Ricinus communis] gi|223547922|gb|EEF49414.1| Protein C14orf111, putative [Ricinus communis] Length = 198 Score = 92.0 bits (227), Expect = 4e-17 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 163 MGKAKKSPKFAVMKKIVTSKANKHYKQEVLNPNKKDLTKEKLPRNVPYVSSALF 2 MG+AKK PKFA MKKI+TSKA KHYK+EVLNP KKDL+K+KLPRNVP VSSAL+ Sbjct: 1 MGRAKKGPKFAAMKKIITSKAIKHYKEEVLNPKKKDLSKDKLPRNVPQVSSALY 54 >ref|XP_002512860.1| Protein C14orf111, putative [Ricinus communis] gi|223547871|gb|EEF49363.1| Protein C14orf111, putative [Ricinus communis] Length = 225 Score = 92.0 bits (227), Expect = 4e-17 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -3 Query: 163 MGKAKKSPKFAVMKKIVTSKANKHYKQEVLNPNKKDLTKEKLPRNVPYVSSALF 2 MG+AKK PKFA MKKI+TSKA KHYK+EVLNP KKDL+K+KLPRNVP VSSAL+ Sbjct: 1 MGRAKKGPKFAAMKKIITSKAIKHYKEEVLNPKKKDLSKDKLPRNVPQVSSALY 54 >ref|XP_004136642.1| PREDICTED: rRNA-processing protein FCF1 homolog [Cucumis sativus] gi|449511643|ref|XP_004164015.1| PREDICTED: rRNA-processing protein FCF1 homolog [Cucumis sativus] Length = 198 Score = 88.6 bits (218), Expect = 5e-16 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 163 MGKAKKSPKFAVMKKIVTSKANKHYKQEVLNPNKKDLTKEKLPRNVPYVSSALF 2 MG+AKK PKFAVMKK+VTSKA K+YK+EVLNP +KDLTKE LPRNVP V SALF Sbjct: 1 MGRAKKGPKFAVMKKMVTSKAIKNYKEEVLNPKRKDLTKENLPRNVPNVPSALF 54 >ref|XP_003540279.1| PREDICTED: rRNA-processing protein FCF1 homolog [Glycine max] gi|356550034|ref|XP_003543395.1| PREDICTED: rRNA-processing protein FCF1 homolog [Glycine max] Length = 198 Score = 88.2 bits (217), Expect = 6e-16 Identities = 45/54 (83%), Positives = 47/54 (87%) Frame = -3 Query: 163 MGKAKKSPKFAVMKKIVTSKANKHYKQEVLNPNKKDLTKEKLPRNVPYVSSALF 2 MGKAKK PKFAVMKKIVTSKA K YK+EVLNP KK+L KEKLPRNVP SSALF Sbjct: 1 MGKAKKGPKFAVMKKIVTSKAIKSYKEEVLNPEKKNLMKEKLPRNVPTHSSALF 54 >gb|ACU19577.1| unknown [Glycine max] Length = 198 Score = 88.2 bits (217), Expect = 6e-16 Identities = 45/54 (83%), Positives = 47/54 (87%) Frame = -3 Query: 163 MGKAKKSPKFAVMKKIVTSKANKHYKQEVLNPNKKDLTKEKLPRNVPYVSSALF 2 MGKAKK PKFAVMKKIVTSKA K YK+EVLNP KK+L KEKLPRNVP SSALF Sbjct: 1 MGKAKKGPKFAVMKKIVTSKAIKSYKEEVLNPEKKNLMKEKLPRNVPTHSSALF 54