BLASTX nr result
ID: Lithospermum22_contig00018768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00018768 (1237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002876670.1| agenet domain-containing protein [Arabidopsi... 57 1e-05 >ref|XP_002876670.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322508|gb|EFH52929.1| agenet domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 721 Score = 57.0 bits (136), Expect = 1e-05 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 109 ENSQSWPFTKKSGMWKVIESMEVFKKVPQMPHFSPL 2 E++ PF KKS +WKV+ESMEVFK VPQ PHFSPL Sbjct: 535 ESTMVLPFVKKSQLWKVLESMEVFKTVPQRPHFSPL 570