BLASTX nr result
ID: Lithospermum22_contig00018488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00018488 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG49895.1| PnFL-1 [Ipomoea nil] 63 2e-08 >gb|AAG49895.1| PnFL-1 [Ipomoea nil] Length = 209 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 108 KHRFRRPRPLYNKNMSIAFAVDQFSFPSGHSSRVFF 1 KH +RPRP+YNKNM ++FAVD +SFPSGHSSRVFF Sbjct: 92 KHLIQRPRPVYNKNMFLSFAVDHWSFPSGHSSRVFF 127