BLASTX nr result
ID: Lithospermum22_contig00018419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00018419 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulg... 59 5e-07 emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] 58 7e-07 dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] 55 6e-06 >ref|NP_063976.1| orf114a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435087|ref|YP_004222305.1| hypothetical protein BevumaM_p070 [Beta vulgaris subsp. maritima] gi|346683178|ref|YP_004842110.1| hypothetical protein BemaM_p065 [Beta macrocarpa] gi|9049278|dbj|BAA99288.1| orf114a [Beta vulgaris subsp. vulgaris] gi|317905640|emb|CBJ14041.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439820|emb|CBJ17532.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500096|emb|CBX24914.1| hypothetical protein [Beta macrocarpa] gi|384977899|emb|CBL54123.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 114 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -1 Query: 257 LVKIPIVIHFPKDPGFRTLVGLQDPFDDLCCEEGIYI*SD 138 L + I IHF DPGFR LVGL+DPFDDLCC EGI I SD Sbjct: 3 LCTLRIGIHFLTDPGFRALVGLRDPFDDLCCVEGISICSD 42 >emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] Length = 142 Score = 58.2 bits (139), Expect = 7e-07 Identities = 37/67 (55%), Positives = 42/67 (62%), Gaps = 8/67 (11%) Frame = +1 Query: 139 SD*IYIPSSQHRSSKGSWRPTKVRKPGSFGKWITIGILTSQPSKFRTLT--------ILL 294 SD I IPS+QHRSSKGS RPTK RK GSF KWI I + ++ K TLT I L Sbjct: 75 SDHIDIPSTQHRSSKGSRRPTKARKSGSFRKWIPIRRVHNRMDKL-TLTRQFGIHFGIFL 133 Query: 295 GWWHEGI 315 G + EGI Sbjct: 134 GRYREGI 140 >dbj|BAD66815.1| orf174 [Beta vulgaris subsp. vulgaris] Length = 174 Score = 55.1 bits (131), Expect = 6e-06 Identities = 33/59 (55%), Positives = 38/59 (64%) Frame = +1 Query: 139 SD*IYIPSSQHRSSKGSWRPTKVRKPGSFGKWITIGILTSQPSKFRTLTILLGWWHEGI 315 S+ I IPS+QHRSSKGS RPTK RKPGS KWI I + ++ K TLT G GI Sbjct: 106 SEHIDIPSTQHRSSKGSRRPTKARKPGSVRKWIPIRRVHNRMDKL-TLTRQFGMIQFGI 163