BLASTX nr result
ID: Lithospermum22_contig00018352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00018352 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001233972.1| jasmonic acid 2 [Solanum lycopersicum] gi|61... 71 8e-11 emb|CCO75402.1| Nac2 transcription factor [Arachis hypogaea] 70 1e-10 gb|ADM94307.1| NAC transcription factor [Arachis hypogaea] 70 1e-10 dbj|BAJ33621.1| unnamed protein product [Thellungiella halophila] 70 1e-10 ref|XP_002867505.1| hypothetical protein ARALYDRAFT_492058 [Arab... 70 1e-10 >ref|NP_001233972.1| jasmonic acid 2 [Solanum lycopersicum] gi|6175246|gb|AAF04915.1|AF011555_1 jasmonic acid 2 [Solanum lycopersicum] Length = 349 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 104 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYLCK 3 MGVQEKDPL QLSLPPGFRF+PTDEELLVQYLCK Sbjct: 1 MGVQEKDPLLQLSLPPGFRFYPTDEELLVQYLCK 34 >emb|CCO75402.1| Nac2 transcription factor [Arachis hypogaea] Length = 349 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 104 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYLCK 3 MG+QEKDPL+QLSLPPGFRF+PTDEELLVQYLC+ Sbjct: 1 MGIQEKDPLSQLSLPPGFRFYPTDEELLVQYLCR 34 >gb|ADM94307.1| NAC transcription factor [Arachis hypogaea] Length = 349 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 104 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYLCK 3 MG+QEKDPL+QLSLPPGFRF+PTDEELLVQYLC+ Sbjct: 1 MGIQEKDPLSQLSLPPGFRFYPTDEELLVQYLCR 34 >dbj|BAJ33621.1| unnamed protein product [Thellungiella halophila] Length = 305 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 104 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYLCK 3 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYLC+ Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYLCR 34 >ref|XP_002867505.1| hypothetical protein ARALYDRAFT_492058 [Arabidopsis lyrata subsp. lyrata] gi|297313341|gb|EFH43764.1| hypothetical protein ARALYDRAFT_492058 [Arabidopsis lyrata subsp. lyrata] Length = 314 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 104 MGVQEKDPLAQLSLPPGFRFFPTDEELLVQYLCK 3 MGV+EKDPLAQLSLPPGFRF+PTDEELLVQYLC+ Sbjct: 1 MGVREKDPLAQLSLPPGFRFYPTDEELLVQYLCR 34