BLASTX nr result
ID: Lithospermum22_contig00018126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00018126 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522814.1| Chitin-inducible gibberellin-responsive prot... 61 8e-08 >ref|XP_002522814.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus communis] gi|223537898|gb|EEF39512.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus communis] Length = 459 Score = 61.2 bits (147), Expect = 8e-08 Identities = 38/79 (48%), Positives = 47/79 (59%), Gaps = 1/79 (1%) Frame = +1 Query: 1 HTLRQLETALMEPDEEDEVTMPAHPATASHRPQ-GYQRSSSWIQRQQGSTSTESQPQPVY 177 H L QLETALM PD+ED ++MP + S RPQ QR+ +W Q +QGS QPQP + Sbjct: 110 HRLLQLETALMGPDDED-ISMPNNALGESSRPQTSGQRTRAWCQERQGSRVI--QPQPSF 166 Query: 178 VSRVENLDKTPQREKRHKG 234 VSR + EK HKG Sbjct: 167 VSRQRQACEGSSVEKYHKG 185