BLASTX nr result
ID: Lithospermum22_contig00017926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00017926 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529747.1| conserved hypothetical protein [Ricinus comm... 67 8e-12 ref|XP_002309816.1| predicted protein [Populus trichocarpa] gi|2... 69 8e-12 emb|CAN60580.1| hypothetical protein VITISV_034776 [Vitis vinifera] 69 2e-11 ref|XP_002264307.2| PREDICTED: uncharacterized protein LOC100261... 69 2e-11 ref|XP_002327959.1| predicted protein [Populus trichocarpa] gi|2... 67 3e-10 >ref|XP_002529747.1| conserved hypothetical protein [Ricinus communis] gi|223530745|gb|EEF32613.1| conserved hypothetical protein [Ricinus communis] Length = 228 Score = 66.6 bits (161), Expect(2) = 8e-12 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 3/42 (7%) Frame = -2 Query: 119 VFLEGYVD---SGEEDELSRTRSLTDDDLDELKGCLDLGFGF 3 V LEGYV+ + EED+L RT+SLTDDDLDELKGCLDLGFGF Sbjct: 81 VLLEGYVEVASNNEEDDLKRTKSLTDDDLDELKGCLDLGFGF 122 Score = 28.1 bits (61), Expect(2) = 8e-12 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 225 SKDEYKKKKNQVFLEGY 175 S+ KKKKNQV LEGY Sbjct: 70 SRSNSKKKKNQVLLEGY 86 >ref|XP_002309816.1| predicted protein [Populus trichocarpa] gi|222852719|gb|EEE90266.1| predicted protein [Populus trichocarpa] Length = 198 Score = 69.3 bits (168), Expect(2) = 8e-12 Identities = 34/42 (80%), Positives = 36/42 (85%), Gaps = 3/42 (7%) Frame = -2 Query: 119 VFLEGYVD---SGEEDELSRTRSLTDDDLDELKGCLDLGFGF 3 V LEGYV+ SG EDEL RT+SLTDDDLDELKGCLDLGFGF Sbjct: 74 VLLEGYVEGSSSGSEDELKRTKSLTDDDLDELKGCLDLGFGF 115 Score = 25.4 bits (54), Expect(2) = 8e-12 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 12/59 (20%) Frame = -1 Query: 315 EENSNNPSSQNGLFFRDN------------QDLLSRKSESFRSKDEYKKKKNQVFLEGY 175 +EN N + N F D+ Q+ KS + S + ++KK+QV LEGY Sbjct: 21 KENQENDQTHNVDFLADDVLETEQVWQYMHQNNTFTKSINKGSLQKIQRKKSQVLLEGY 79 >emb|CAN60580.1| hypothetical protein VITISV_034776 [Vitis vinifera] Length = 295 Score = 68.9 bits (167), Expect(2) = 2e-11 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 119 VFLEGYVDSGEEDELSRTRSLTDDDLDELKGCLDLGFGF 3 V LEGYV++ +ED+L RT+SLTD+DLDELKGCLDLGFGF Sbjct: 67 VLLEGYVETADEDDLMRTKSLTDEDLDELKGCLDLGFGF 105 Score = 24.3 bits (51), Expect(2) = 2e-11 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 240 SESFRSKDEYKKKKNQVFLEGY 175 + S K + +KKK QV LEGY Sbjct: 51 TNSGSKKKKKQKKKKQVLLEGY 72 >ref|XP_002264307.2| PREDICTED: uncharacterized protein LOC100261066 isoform 1 [Vitis vinifera] gi|359478114|ref|XP_003632071.1| PREDICTED: uncharacterized protein LOC100261066 isoform 2 [Vitis vinifera] Length = 185 Score = 68.9 bits (167), Expect(2) = 2e-11 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 119 VFLEGYVDSGEEDELSRTRSLTDDDLDELKGCLDLGFGF 3 V LEGYV++ +ED+L RT+SLTD+DLDELKGCLDLGFGF Sbjct: 67 VLLEGYVETADEDDLMRTKSLTDEDLDELKGCLDLGFGF 105 Score = 24.3 bits (51), Expect(2) = 2e-11 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 240 SESFRSKDEYKKKKNQVFLEGY 175 + S K + +KKK QV LEGY Sbjct: 51 TNSGSKKKKKQKKKKQVLLEGY 72 >ref|XP_002327959.1| predicted protein [Populus trichocarpa] gi|222837368|gb|EEE75747.1| predicted protein [Populus trichocarpa] Length = 151 Score = 67.4 bits (163), Expect(2) = 3e-10 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = -2 Query: 119 VFLEGYVD--SGEEDELSRTRSLTDDDLDELKGCLDLGFGF 3 V LEGYV+ S EDEL RT+SLTDDDLDELKGCLDLGFGF Sbjct: 26 VLLEGYVEGRSNSEDELKRTKSLTDDDLDELKGCLDLGFGF 66 Score = 22.3 bits (46), Expect(2) = 3e-10 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 264 NQDLLSRKSESFRSKDEYKKKKNQVFLEGY 175 NQ+ K+ + S + +KK+QV LEGY Sbjct: 2 NQNNTFTKNFNKGSLRKILRKKSQVLLEGY 31