BLASTX nr result
ID: Lithospermum22_contig00017791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00017791 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP20221.1| MAP kinase [Nicotiana tabacum] 62 5e-08 >gb|AFP20221.1| MAP kinase [Nicotiana tabacum] Length = 594 Score = 62.0 bits (149), Expect = 5e-08 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 2/72 (2%) Frame = -1 Query: 210 GGGTFVDGVRKLFQRRXXXXXXXXXSHNN--NILDKENAILIKENYQEEGEINVIEDFDI 37 GG TFVDG R+ FQRR H+N +IL+ N ++ EE E+ +IEDFDI Sbjct: 3 GGNTFVDGFRRWFQRRSTTTTTTTIVHSNADSILNSNNFEKKPIHFSEE-ELTIIEDFDI 61 Query: 36 SGLKFIKVPKRV 1 SGLK I VPKRV Sbjct: 62 SGLKLISVPKRV 73