BLASTX nr result
ID: Lithospermum22_contig00017780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00017780 (586 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW69827.1| Hop-interacting protein THI142 [Solanum lycopersi... 62 7e-08 ref|XP_002518413.1| heat shock protein 70 (HSP70)-interacting pr... 60 3e-07 ref|XP_003549628.1| PREDICTED: uncharacterized protein LOC100786... 59 5e-07 ref|XP_003529654.1| PREDICTED: uncharacterized protein LOC100784... 59 5e-07 gb|AAB38779.1| putative cytoskeletal protein [Arabidopsis thaliana] 57 2e-06 >gb|AEW69827.1| Hop-interacting protein THI142 [Solanum lycopersicum] Length = 761 Score = 62.0 bits (149), Expect = 7e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 560 GWKENLDTAMERFKLAGASETDISTVLKNHC 468 GWKE LDTA+ERFKLAGASE DISTVLKNHC Sbjct: 705 GWKEKLDTAVERFKLAGASEIDISTVLKNHC 735 >ref|XP_002518413.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223542258|gb|EEF43800.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Length = 748 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 560 GWKENLDTAMERFKLAGASETDISTVLKNHC 468 GWK+NLDTA+ERF+LAGASE DIS VLKNHC Sbjct: 685 GWKKNLDTAVERFRLAGASEADISMVLKNHC 715 >ref|XP_003549628.1| PREDICTED: uncharacterized protein LOC100786963 [Glycine max] Length = 776 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 560 GWKENLDTAMERFKLAGASETDISTVLKNHC 468 GWKENLD A ERFKLAGASE D+S VLKNHC Sbjct: 714 GWKENLDAATERFKLAGASEADVSMVLKNHC 744 >ref|XP_003529654.1| PREDICTED: uncharacterized protein LOC100784987 [Glycine max] Length = 769 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 560 GWKENLDTAMERFKLAGASETDISTVLKNHC 468 GWKENLD A ERFKLAGASE D+S VLKNHC Sbjct: 707 GWKENLDAATERFKLAGASEADVSMVLKNHC 737 >gb|AAB38779.1| putative cytoskeletal protein [Arabidopsis thaliana] Length = 782 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 560 GWKENLDTAMERFKLAGASETDISTVLKNHC 468 GW +NLD+A+ERFKLAGASE DI+TV+KNHC Sbjct: 705 GWNKNLDSAVERFKLAGASEADIATVVKNHC 735