BLASTX nr result
ID: Lithospermum22_contig00017370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00017370 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511505.1| pentatricopeptide repeat-containing protein,... 168 5e-40 ref|XP_002890305.1| pentatricopeptide repeat-containing protein ... 167 8e-40 ref|XP_002887557.1| pentatricopeptide repeat-containing protein ... 167 1e-39 gb|AAF79278.1|AC068602_1 F14D16.2 [Arabidopsis thaliana] 164 7e-39 ref|NP_173324.1| pentatricopeptide repeat-containing protein [Ar... 164 7e-39 >ref|XP_002511505.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550620|gb|EEF52107.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 876 Score = 168 bits (425), Expect = 5e-40 Identities = 78/96 (81%), Positives = 89/96 (92%) Frame = +3 Query: 3 MSDGTAVIALSRTLAWFRKQMILSGTCPNRIDIVTGWGRRSRVTGTSLVRQAVQDLLKMF 182 MSDGTAV ALSRTLAWFR+QM++SG P+RIDIVTGWGRRSRVTG+S+VRQAVQ+LL +F Sbjct: 781 MSDGTAVTALSRTLAWFRQQMLVSGISPSRIDIVTGWGRRSRVTGSSMVRQAVQELLHIF 840 Query: 183 YFPFHTESGNSGCFVGCGDTLNRWLLQPYVERMHLL 290 FPF TE+GNSGCFVGCG+ LNRWLLQPYV+RMHLL Sbjct: 841 SFPFFTENGNSGCFVGCGEPLNRWLLQPYVDRMHLL 876 >ref|XP_002890305.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336147|gb|EFH66564.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 860 Score = 167 bits (423), Expect = 8e-40 Identities = 77/96 (80%), Positives = 90/96 (93%) Frame = +3 Query: 3 MSDGTAVIALSRTLAWFRKQMILSGTCPNRIDIVTGWGRRSRVTGTSLVRQAVQDLLKMF 182 MS+GTAV ALSRTLAWFR+QM++SGTCP+RIDIVTGWGRRSRVTGTS+VRQAV++LL +F Sbjct: 765 MSEGTAVTALSRTLAWFRRQMLVSGTCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIF 824 Query: 183 YFPFHTESGNSGCFVGCGDTLNRWLLQPYVERMHLL 290 PF TESGNSGCFVGCG++LN+WLLQ +VERMHLL Sbjct: 825 GSPFFTESGNSGCFVGCGESLNKWLLQSHVERMHLL 860 >ref|XP_002887557.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297333398|gb|EFH63816.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 845 Score = 167 bits (422), Expect = 1e-39 Identities = 76/96 (79%), Positives = 89/96 (92%) Frame = +3 Query: 3 MSDGTAVIALSRTLAWFRKQMILSGTCPNRIDIVTGWGRRSRVTGTSLVRQAVQDLLKMF 182 MS+GTAVIALSRTLAWFRKQM+++G CP+RIDIVTGWGRRSRVTGTS+VRQAV++LL +F Sbjct: 750 MSEGTAVIALSRTLAWFRKQMLVTGDCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIF 809 Query: 183 YFPFHTESGNSGCFVGCGDTLNRWLLQPYVERMHLL 290 FPF TE+GNSGCFVGCG+ L +WLL+ YVERMHLL Sbjct: 810 NFPFFTENGNSGCFVGCGEPLKKWLLESYVERMHLL 845 >gb|AAF79278.1|AC068602_1 F14D16.2 [Arabidopsis thaliana] Length = 977 Score = 164 bits (415), Expect = 7e-39 Identities = 78/96 (81%), Positives = 87/96 (90%) Frame = +3 Query: 3 MSDGTAVIALSRTLAWFRKQMILSGTCPNRIDIVTGWGRRSRVTGTSLVRQAVQDLLKMF 182 MS+GTAV ALSRTLAWFRKQM+ SGTCP+RIDIVTGWGRRSRVTGTS+VRQAV++LL +F Sbjct: 882 MSEGTAVTALSRTLAWFRKQMLASGTCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIF 941 Query: 183 YFPFHTESGNSGCFVGCGDTLNRWLLQPYVERMHLL 290 PF TESGNSGCFVG G+ LNRWLLQ +VERMHLL Sbjct: 942 GSPFFTESGNSGCFVGSGEPLNRWLLQSHVERMHLL 977 >ref|NP_173324.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|42571539|ref|NP_973860.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75151479|sp|Q8GYP6.1|PPR49_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g18900 gi|26450017|dbj|BAC42129.1| unknown protein [Arabidopsis thaliana] gi|28827402|gb|AAO50545.1| unknown protein [Arabidopsis thaliana] gi|332191657|gb|AEE29778.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332191658|gb|AEE29779.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 860 Score = 164 bits (415), Expect = 7e-39 Identities = 78/96 (81%), Positives = 87/96 (90%) Frame = +3 Query: 3 MSDGTAVIALSRTLAWFRKQMILSGTCPNRIDIVTGWGRRSRVTGTSLVRQAVQDLLKMF 182 MS+GTAV ALSRTLAWFRKQM+ SGTCP+RIDIVTGWGRRSRVTGTS+VRQAV++LL +F Sbjct: 765 MSEGTAVTALSRTLAWFRKQMLASGTCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIF 824 Query: 183 YFPFHTESGNSGCFVGCGDTLNRWLLQPYVERMHLL 290 PF TESGNSGCFVG G+ LNRWLLQ +VERMHLL Sbjct: 825 GSPFFTESGNSGCFVGSGEPLNRWLLQSHVERMHLL 860