BLASTX nr result
ID: Lithospermum22_contig00016925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00016925 (768 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323498.1| predicted protein [Populus trichocarpa] gi|2... 57 3e-06 >ref|XP_002323498.1| predicted protein [Populus trichocarpa] gi|222868128|gb|EEF05259.1| predicted protein [Populus trichocarpa] Length = 115 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/58 (44%), Positives = 38/58 (65%) Frame = +2 Query: 284 HHYISFKITNTNHRN*KTQQDPYLRGQNIYNYVAGSVPCSPSHLTTTTSETIPNPAFL 457 HH+I+ K+T N+ + Q PYLRGQN++ Y+ GSVPC P+ +S IPNP ++ Sbjct: 22 HHFITIKLTQDNYLLWRAQLIPYLRGQNLFGYLDGSVPC-PAITIPNSSTHIPNPEYI 78