BLASTX nr result
ID: Lithospermum22_contig00016597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00016597 (729 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299164.1| predicted protein [Populus trichocarpa] gi|2... 95 1e-17 gb|ABK96444.1| unknown [Populus trichocarpa x Populus deltoides] 95 2e-17 ref|XP_002512777.1| conserved hypothetical protein [Ricinus comm... 92 8e-17 ref|XP_002303969.1| predicted protein [Populus trichocarpa] gi|2... 89 7e-16 ref|XP_003543715.1| PREDICTED: uncharacterized protein LOC100804... 89 9e-16 >ref|XP_002299164.1| predicted protein [Populus trichocarpa] gi|222846422|gb|EEE83969.1| predicted protein [Populus trichocarpa] Length = 92 Score = 95.1 bits (235), Expect = 1e-17 Identities = 39/62 (62%), Positives = 53/62 (85%) Frame = -1 Query: 336 LLKLRDDIQTCGYQDVQIMWEMLSQTESETINSHLAKKQRPFWRIFVWSDQNRASAFSTN 157 LLKL +D+QTCGY+DVQ+MWE+L ++ESE + SH +KQRPFWR+FVWS+ + AS+FS N Sbjct: 31 LLKLHNDVQTCGYEDVQVMWEILRRSESELMASHPKRKQRPFWRVFVWSNHSAASSFSAN 90 Query: 156 HA 151 H+ Sbjct: 91 HS 92 >gb|ABK96444.1| unknown [Populus trichocarpa x Populus deltoides] Length = 92 Score = 94.7 bits (234), Expect = 2e-17 Identities = 39/62 (62%), Positives = 53/62 (85%) Frame = -1 Query: 336 LLKLRDDIQTCGYQDVQIMWEMLSQTESETINSHLAKKQRPFWRIFVWSDQNRASAFSTN 157 LLKL +D+QTCGY+DVQ+MWE+L ++ESE + SH +KQRPFWR+FVWS+ + AS+FS N Sbjct: 31 LLKLHNDVQTCGYEDVQVMWEILRRSESELMASHPKRKQRPFWRVFVWSNHSAASSFSPN 90 Query: 156 HA 151 H+ Sbjct: 91 HS 92 >ref|XP_002512777.1| conserved hypothetical protein [Ricinus communis] gi|223547788|gb|EEF49280.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 92.4 bits (228), Expect = 8e-17 Identities = 40/62 (64%), Positives = 51/62 (82%) Frame = -1 Query: 336 LLKLRDDIQTCGYQDVQIMWEMLSQTESETINSHLAKKQRPFWRIFVWSDQNRASAFSTN 157 LLKLR+D+QTCGY+DVQ+MWEML ++ESE I ++ +KQR FWR VWS+QN AS+ S N Sbjct: 31 LLKLRNDVQTCGYEDVQVMWEMLRRSESEQIANYSKRKQRSFWRALVWSNQNAASSLSAN 90 Query: 156 HA 151 HA Sbjct: 91 HA 92 >ref|XP_002303969.1| predicted protein [Populus trichocarpa] gi|222841401|gb|EEE78948.1| predicted protein [Populus trichocarpa] Length = 90 Score = 89.4 bits (220), Expect = 7e-16 Identities = 37/62 (59%), Positives = 52/62 (83%) Frame = -1 Query: 336 LLKLRDDIQTCGYQDVQIMWEMLSQTESETINSHLAKKQRPFWRIFVWSDQNRASAFSTN 157 LL+L +D+QTCGY+DVQ+MWE+L ++ESE + S +KQRPFWR+FVWS+ + AS+FS N Sbjct: 29 LLELHNDVQTCGYEDVQVMWEILRRSESELMASLPKRKQRPFWRVFVWSNHSAASSFSAN 88 Query: 156 HA 151 H+ Sbjct: 89 HS 90 >ref|XP_003543715.1| PREDICTED: uncharacterized protein LOC100804925 [Glycine max] Length = 90 Score = 89.0 bits (219), Expect = 9e-16 Identities = 40/62 (64%), Positives = 48/62 (77%) Frame = -1 Query: 336 LLKLRDDIQTCGYQDVQIMWEMLSQTESETINSHLAKKQRPFWRIFVWSDQNRASAFSTN 157 LLKL+DD+QTCGYQDVQ+MWEML +TE E I +H +KQ PFWRIFVWS+ + S N Sbjct: 31 LLKLQDDVQTCGYQDVQVMWEMLQRTEGEVIENHHKRKQFPFWRIFVWSNHTQ----SAN 86 Query: 156 HA 151 HA Sbjct: 87 HA 88