BLASTX nr result
ID: Lithospermum22_contig00016366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00016366 (405 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320202.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002523344.1| protein with unknown function [Ricinus commu... 68 9e-10 ref|XP_002318417.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_002516697.1| ubiquitin, putative [Ricinus communis] gi|22... 65 4e-09 emb|CBI34497.3| unnamed protein product [Vitis vinifera] 64 1e-08 >ref|XP_002320202.1| predicted protein [Populus trichocarpa] gi|222860975|gb|EEE98517.1| predicted protein [Populus trichocarpa] Length = 326 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -2 Query: 404 IMCRETLHTESVIEEIVQEAFDSVLPDSSESALLETISSVMDRRLDNVA 258 IMCRETL ES+IEEIVQEA DS LP +SE+ LET+S +MDRRLD +A Sbjct: 274 IMCRETLKKESIIEEIVQEAQDSTLPVTSEALFLETVSHIMDRRLDEIA 322 >ref|XP_002523344.1| protein with unknown function [Ricinus communis] gi|223537432|gb|EEF39060.1| protein with unknown function [Ricinus communis] Length = 585 Score = 67.8 bits (164), Expect = 9e-10 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -2 Query: 404 IMCRETLHTESVIEEIVQEAFDSVLPDSSESALLETISSVMDRRLDNVA 258 IMCRETL S+IEEIVQEA D VLP +SE A LET+S +MDRRLD +A Sbjct: 533 IMCRETLKKASLIEEIVQEAQDCVLPGTSEVAFLETVSHIMDRRLDEIA 581 >ref|XP_002318417.1| predicted protein [Populus trichocarpa] gi|222859090|gb|EEE96637.1| predicted protein [Populus trichocarpa] Length = 300 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 404 IMCRETLHTESVIEEIVQEAFDSVLPDSSESALLETISSVMDRRLDNVA 258 +MCRET+ ESVIE+IVQEA D+VLP SSE+A LE +S +MDRRLD ++ Sbjct: 252 LMCRETVKKESVIEQIVQEAHDAVLPGSSEAAFLEAVSLIMDRRLDKLS 300 >ref|XP_002516697.1| ubiquitin, putative [Ricinus communis] gi|223544192|gb|EEF45716.1| ubiquitin, putative [Ricinus communis] Length = 583 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -2 Query: 404 IMCRETLHTESVIEEIVQEAFDSVLPDSSESALLETISSVMDRRLDNVA 258 IMCRET+ ES IE I+QEA D+VLP+SSE+A LE ++S+MD RLD ++ Sbjct: 534 IMCRETMKKESAIERIIQEAQDAVLPESSEAAFLECVASIMDHRLDELS 582 >emb|CBI34497.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -2 Query: 404 IMCRETLHTESVIEEIVQEAFDSVLPDSSESALLETISSVMDRRLDNV 261 IMCR TL+ ESVIEEIVQEA DS+LP SE+A LETIS ++D RLD + Sbjct: 467 IMCRVTLNKESVIEEIVQEAQDSLLPGMSEAAFLETISQLIDTRLDKL 514