BLASTX nr result
ID: Lithospermum22_contig00016219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00016219 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521033.1| PREDICTED: protein WAX2-like [Glycine max] 75 4e-12 gb|ADN34102.1| sterol desaturase [Cucumis melo subsp. melo] 74 1e-11 ref|XP_003530144.1| PREDICTED: protein WAX2-like [Glycine max] 74 2e-11 ref|XP_002526512.1| sterol desaturase, putative [Ricinus communi... 74 2e-11 ref|XP_004168237.1| PREDICTED: protein ECERIFERUM 1-like, partia... 73 3e-11 >ref|XP_003521033.1| PREDICTED: protein WAX2-like [Glycine max] Length = 624 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -3 Query: 329 PFLLLRMLNDQIWTSLSRYKTAKGKARIVDKSIEFDQVDRERSW 198 PFLL RML++QIW + SRY+TAKG ARIVDK IEFDQVDRER+W Sbjct: 52 PFLLWRMLHNQIWITFSRYRTAKGNARIVDKGIEFDQVDRERNW 95 >gb|ADN34102.1| sterol desaturase [Cucumis melo subsp. melo] Length = 618 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -3 Query: 329 PFLLLRMLNDQIWTSLSRYKTAKGKARIVDKSIEFDQVDRERSW 198 PFLLLRM+++QIW SLSRY+TAKG RIVDK IEF+QVDRE SW Sbjct: 51 PFLLLRMIHNQIWISLSRYQTAKGTKRIVDKPIEFEQVDRESSW 94 >ref|XP_003530144.1| PREDICTED: protein WAX2-like [Glycine max] Length = 625 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 329 PFLLLRMLNDQIWTSLSRYKTAKGKARIVDKSIEFDQVDRERSW 198 PFLL RML++QIW +LSR++TAKG RIVDK IEFDQVDRER+W Sbjct: 52 PFLLWRMLHNQIWITLSRHRTAKGNGRIVDKGIEFDQVDRERNW 95 >ref|XP_002526512.1| sterol desaturase, putative [Ricinus communis] gi|223534187|gb|EEF35903.1| sterol desaturase, putative [Ricinus communis] Length = 622 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 329 PFLLLRMLNDQIWTSLSRYKTAKGKARIVDKSIEFDQVDRERSW 198 PFLL RM+++Q+W SLSRY+TAKG RI+DK IEFDQVDRER+W Sbjct: 50 PFLLWRMVHNQLWISLSRYRTAKGNNRIIDKGIEFDQVDRERNW 93 >ref|XP_004168237.1| PREDICTED: protein ECERIFERUM 1-like, partial [Cucumis sativus] Length = 598 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 329 PFLLLRMLNDQIWTSLSRYKTAKGKARIVDKSIEFDQVDRERSW 198 PFL+LRM+++QIW SLSRY+TAKG RIVDK IEF+QVDRE SW Sbjct: 31 PFLVLRMIHNQIWISLSRYQTAKGTKRIVDKPIEFEQVDRESSW 74