BLASTX nr result
ID: Lithospermum22_contig00016211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00016211 (983 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAP16663.1| tetratricopeptide repeat protein [Solanum lycope... 45 2e-07 ref|XP_003622987.1| Tetratricopeptide repeat protein [Medicago t... 43 4e-06 >emb|CAP16663.1| tetratricopeptide repeat protein [Solanum lycopersicum] Length = 261 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = +2 Query: 437 RRNIIRLKPMADEKREKMKEEIIGETFKNLINIQINRCLKLCDGFYTL 580 RR +I LKP+ADEKREKMKEE+IG+ K + N + R D F T+ Sbjct: 201 RRTVILLKPLADEKREKMKEEMIGK-LKEMGNSILGRFGMSVDNFKTV 247 Score = 36.6 bits (83), Expect(2) = 2e-07 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +1 Query: 310 TDMTKILELHPSFDKARRNIIRL 378 TDMTKILEL PS D+ARR +I L Sbjct: 185 TDMTKILELEPSHDQARRTVILL 207 >ref|XP_003622987.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355498002|gb|AES79205.1| Tetratricopeptide repeat protein [Medicago truncatula] Length = 271 Score = 42.7 bits (99), Expect(2) = 4e-06 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +1 Query: 697 FWDDLDNFKAVKDPNTGSYSVLMQR 771 F LDNFKAVKDPNTGSYS+ M+R Sbjct: 247 FGMSLDNFKAVKDPNTGSYSISMER 271 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 660 FCTGKLKEMGNSILGRFG 713 +C KLKEMGNS+LGRFG Sbjct: 231 WCVEKLKEMGNSVLGRFG 248