BLASTX nr result
ID: Lithospermum22_contig00016073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00016073 (942 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003557964.1| PREDICTED: transcription factor RF2b-like [B... 92 1e-16 dbj|BAK00487.1| predicted protein [Hordeum vulgare subsp. vulgare] 92 1e-16 gb|ACN26156.1| unknown [Zea mays] gi|408690274|gb|AFU81597.1| bZ... 91 3e-16 ref|XP_002520865.1| Transcription factor RF2b, putative [Ricinus... 91 3e-16 ref|NP_001152693.1| LOC100286334 [Zea mays] gi|195659063|gb|ACG4... 91 3e-16 >ref|XP_003557964.1| PREDICTED: transcription factor RF2b-like [Brachypodium distachyon] Length = 358 Score = 92.4 bits (228), Expect = 1e-16 Identities = 47/50 (94%), Positives = 50/50 (100%) Frame = +1 Query: 793 RILANRQSAARSKERKARYMSELERKLQSLQTEATTLSAQLTLFQRDTTG 942 RILANRQSAARSKERKARYM+ELERK+Q+LQTEATTLSAQLTLFQRDTTG Sbjct: 166 RILANRQSAARSKERKARYMTELERKVQTLQTEATTLSAQLTLFQRDTTG 215 >dbj|BAK00487.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 355 Score = 92.4 bits (228), Expect = 1e-16 Identities = 47/50 (94%), Positives = 50/50 (100%) Frame = +1 Query: 793 RILANRQSAARSKERKARYMSELERKLQSLQTEATTLSAQLTLFQRDTTG 942 RILANRQSAARSKERKARYM+ELERK+Q+LQTEATTLSAQLTLFQRDTTG Sbjct: 163 RILANRQSAARSKERKARYMTELERKVQTLQTEATTLSAQLTLFQRDTTG 212 >gb|ACN26156.1| unknown [Zea mays] gi|408690274|gb|AFU81597.1| bZIP-type transcription factor, partial [Zea mays subsp. mays] gi|414866679|tpg|DAA45236.1| TPA: putative bZIP transcription factor superfamily protein [Zea mays] Length = 346 Score = 91.3 bits (225), Expect = 3e-16 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = +1 Query: 793 RILANRQSAARSKERKARYMSELERKLQSLQTEATTLSAQLTLFQRDTTG 942 RILANRQSAARSKERKARYM++LERK+Q+LQTEATTLSAQLTLFQRDTTG Sbjct: 154 RILANRQSAARSKERKARYMTDLERKVQTLQTEATTLSAQLTLFQRDTTG 203 >ref|XP_002520865.1| Transcription factor RF2b, putative [Ricinus communis] gi|223539996|gb|EEF41574.1| Transcription factor RF2b, putative [Ricinus communis] Length = 355 Score = 91.3 bits (225), Expect = 3e-16 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = +1 Query: 793 RILANRQSAARSKERKARYMSELERKLQSLQTEATTLSAQLTLFQRDTTG 942 RI+ANRQSAARSKERKARY+SELERK+Q+LQTEATTLSAQLTLFQRDTTG Sbjct: 159 RIIANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTG 208 >ref|NP_001152693.1| LOC100286334 [Zea mays] gi|195659063|gb|ACG48999.1| transcription factor RF2b [Zea mays] Length = 343 Score = 91.3 bits (225), Expect = 3e-16 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = +1 Query: 793 RILANRQSAARSKERKARYMSELERKLQSLQTEATTLSAQLTLFQRDTTG 942 RILANRQSAARSKERKARYM++LERK+Q+LQTEATTLSAQLTLFQRDTTG Sbjct: 154 RILANRQSAARSKERKARYMTDLERKVQTLQTEATTLSAQLTLFQRDTTG 203