BLASTX nr result
ID: Lithospermum22_contig00015924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00015924 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533352.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002533352.1| conserved hypothetical protein [Ricinus communis] gi|223526817|gb|EEF29037.1| conserved hypothetical protein [Ricinus communis] Length = 112 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/62 (51%), Positives = 35/62 (56%) Frame = -2 Query: 231 MEGLIPLVFKTIKRNRTRSQYEYLSSGTASAGHHQMYNITDFYTNDDSVIRNSPEKTTRP 52 MEGL+PLV+K IKRNRTR QYE LSSG A A YN DFY +D P Sbjct: 1 MEGLLPLVYKAIKRNRTRRQYECLSSGAAFA-----YNPADFYISDAETTYTKPSSIIME 55 Query: 51 AN 46 N Sbjct: 56 KN 57