BLASTX nr result
ID: Lithospermum22_contig00014895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00014895 (728 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525524.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_002329042.1| predicted protein [Populus trichocarpa] gi|2... 59 1e-06 >ref|XP_002525524.1| conserved hypothetical protein [Ricinus communis] gi|223535203|gb|EEF36882.1| conserved hypothetical protein [Ricinus communis] Length = 132 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = +2 Query: 152 LEEDDEGNPFAPPSPHQQRRP-PLDVNNRWEASFKLVVPEFYGTLQADEFLDWL 310 +E++D G+ + PHQ++RP +D N WE+ + +PEF+G+LQA+EFLDWL Sbjct: 28 IEDEDLGDEYDDEVPHQRQRPNAVDNNRHWESGMRTEIPEFHGSLQAEEFLDWL 81 >ref|XP_002329042.1| predicted protein [Populus trichocarpa] gi|222839713|gb|EEE78036.1| predicted protein [Populus trichocarpa] Length = 442 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 4/58 (6%) Frame = +2 Query: 152 LEEDDEG--NPFAPPSPHQ--QRRPPLDVNNRWEASFKLVVPEFYGTLQADEFLDWLN 313 +EE+ EG NPFA HQ QRRP D + RWE K+ +PEF+ LQADE+LDW+N Sbjct: 55 VEEESEGDENPFA----HQPVQRRPAPDESRRWETGLKVDIPEFHVGLQADEYLDWIN 108