BLASTX nr result
ID: Lithospermum22_contig00014809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00014809 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515452.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002515452.1| conserved hypothetical protein [Ricinus communis] gi|223545396|gb|EEF46901.1| conserved hypothetical protein [Ricinus communis] Length = 230 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -3 Query: 122 MFCRMIESATGGIGKRNKKDGTVPVYLNVYDLTPINGYAY 3 M CRM+ + +R KK GTVPVYLNVYDLTPINGYAY Sbjct: 1 MLCRMV------LLQRKKKTGTVPVYLNVYDLTPINGYAY 34