BLASTX nr result
ID: Lithospermum22_contig00014638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00014638 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002885948.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] gi|... 82 6e-14 ref|NP_179101.1| putative indole-3-acetic acid-amido synthetase ... 82 6e-14 ref|XP_004141994.1| PREDICTED: probable indole-3-acetic acid-ami... 81 1e-13 gb|AFC36443.1| GH3-1 [Castanea sativa] 80 1e-13 ref|XP_002527466.1| Indole-3-acetic acid-amido synthetase GH3.3,... 80 1e-13 >ref|XP_002885948.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] gi|297331788|gb|EFH62207.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] Length = 590 Score = 81.6 bits (200), Expect = 6e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 NQYKAPRCVNFTPIMELLDSRLVSVHFSPSLPHWTPERR 119 NQYK PRCVNFTPI+ELLDSR+VS HFSPSLPHWTPERR Sbjct: 550 NQYKVPRCVNFTPIVELLDSRVVSAHFSPSLPHWTPERR 588 >ref|NP_179101.1| putative indole-3-acetic acid-amido synthetase GH3.1 [Arabidopsis thaliana] gi|62900130|sp|O82333.1|GH31_ARATH RecName: Full=Probable indole-3-acetic acid-amido synthetase GH3.1; AltName: Full=Auxin-responsive GH3-like protein 1; Short=AtGH3-1 gi|3650037|gb|AAC61292.1| putative auxin-regulated protein [Arabidopsis thaliana] gi|330251259|gb|AEC06353.1| putative indole-3-acetic acid-amido synthetase GH3.1 [Arabidopsis thaliana] Length = 590 Score = 81.6 bits (200), Expect = 6e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 NQYKAPRCVNFTPIMELLDSRLVSVHFSPSLPHWTPERR 119 NQYK PRCVNFTPI+ELLDSR+VS HFSPSLPHWTPERR Sbjct: 550 NQYKVPRCVNFTPIVELLDSRVVSAHFSPSLPHWTPERR 588 >ref|XP_004141994.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like [Cucumis sativus] gi|449528118|ref|XP_004171053.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like [Cucumis sativus] Length = 588 Score = 80.9 bits (198), Expect = 1e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 3 NQYKAPRCVNFTPIMELLDSRLVSVHFSPSLPHWTPERR 119 NQYKAPRCVNFTPI+ELLDSR+ SVHFSPS PHWTPERR Sbjct: 549 NQYKAPRCVNFTPIIELLDSRVTSVHFSPSKPHWTPERR 587 >gb|AFC36443.1| GH3-1 [Castanea sativa] Length = 603 Score = 80.5 bits (197), Expect = 1e-13 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +3 Query: 3 NQYKAPRCVNFTPIMELLDSRLVSVHFSPSLPHWTPER 116 NQYKAPRCV+FTPIMELLDSR+VSVHFSP+LPHWTP+R Sbjct: 564 NQYKAPRCVSFTPIMELLDSRIVSVHFSPALPHWTPQR 601 >ref|XP_002527466.1| Indole-3-acetic acid-amido synthetase GH3.3, putative [Ricinus communis] gi|223533106|gb|EEF34864.1| Indole-3-acetic acid-amido synthetase GH3.3, putative [Ricinus communis] Length = 597 Score = 80.5 bits (197), Expect = 1e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 NQYKAPRCVNFTPIMELLDSRLVSVHFSPSLPHWTPERR 119 NQYK PRCVNFTPIMELLDSR+VS HFSP+LPHWTP+RR Sbjct: 559 NQYKVPRCVNFTPIMELLDSRVVSTHFSPALPHWTPKRR 597