BLASTX nr result
ID: Lithospermum22_contig00014620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00014620 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55329.1| hypothetical protein 12.t00047 [Asparagus officin... 70 2e-10 >gb|ABB55329.1| hypothetical protein 12.t00047 [Asparagus officinalis] Length = 304 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = +1 Query: 70 VGYYNLPHLNTQRPR*ATT-HPGPYHPCEILEVAPTASRG 186 +GYY LPHLN+QRPR A + HP PYHPCEILEVAPTASRG Sbjct: 253 LGYYKLPHLNSQRPRYAKSYHPRPYHPCEILEVAPTASRG 292