BLASTX nr result
ID: Lithospermum22_contig00014571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00014571 (193 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN33807.1| ty1-copia retrotransposon protein [Cucumis melo s... 61 8e-08 >gb|ADN33807.1| ty1-copia retrotransposon protein [Cucumis melo subsp. melo] Length = 1038 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -3 Query: 158 SKSKLPDMSKLEPLNGNNYKRWSQKLLMYLEALDVDYVLFENRP 27 S LPD+SKLEPL+G NY+RWSQKLL++ + L+VDYVL + P Sbjct: 6 SNKILPDLSKLEPLDGTNYRRWSQKLLIFFKQLEVDYVLTTDLP 49