BLASTX nr result
ID: Lithospermum22_contig00014392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00014392 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319094.1| ethylene receptor 6 [Populus trichocarpa] gi... 54 1e-05 >ref|XP_002319094.1| ethylene receptor 6 [Populus trichocarpa] gi|222857470|gb|EEE95017.1| ethylene receptor 6 [Populus trichocarpa] Length = 763 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 248 VGMNGLIRKPVLLQGLADELRKVLQHAGKGM 156 +GMNG+IRKPVLLQG+ADELR+VLQ AG+G+ Sbjct: 733 MGMNGVIRKPVLLQGMADELRRVLQRAGEGL 763