BLASTX nr result
ID: Lithospermum22_contig00014178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00014178 (669 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531499.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002531499.1| conserved hypothetical protein [Ricinus communis] gi|223528886|gb|EEF30886.1| conserved hypothetical protein [Ricinus communis] Length = 261 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 98 YTAQVISAERLKNYIFHKIINEAPEGPFCIVY 3 + AQVISAERLK YIFHK+ +E PEGPFCIVY Sbjct: 94 FPAQVISAERLKKYIFHKMCSELPEGPFCIVY 125