BLASTX nr result
ID: Lithospermum22_contig00013952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00013952 (553 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 65 7e-09 ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 65.1 bits (157), Expect = 7e-09 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -2 Query: 498 MAENPLSLRSSRFRLAQRCTKQLQQQRARLYIIWRCTMMLLSWQD 364 MA + LS+RS + R QRC+KQ+++QR RLYIIWRCT+MLL W D Sbjct: 20 MAADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 55.1 bits (131), Expect = 7e-06 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -2 Query: 477 LRSSRFRLAQRCTKQLQQQRARLYIIWRCTMMLLSWQD 364 +R +FR QRC++ +++QR RLYIIWRCT++LLSW D Sbjct: 9 IRFPKFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46