BLASTX nr result
ID: Lithospermum22_contig00013823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00013823 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACR56827.1| At3g12630-like protein [Solanum hirtum] 62 5e-08 gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] 62 5e-08 gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] 62 5e-08 gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum] 62 5e-08 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] 62 5e-08 >gb|ACR56827.1| At3g12630-like protein [Solanum hirtum] Length = 151 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 90 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 122 >gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] Length = 147 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 86 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 118 >gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] Length = 87 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 20 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 52 >gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum] Length = 188 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 121 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 153 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] Length = 88 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 134 PMKRKVNRCTGCYKKVGLTGIRCRCGKLFCSNH 232 P KR+VNRC+GC +KVGLTG RCRCG+LFC H Sbjct: 21 PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 53