BLASTX nr result
ID: Lithospermum22_contig00013072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00013072 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511117.1| ubiquitin-conjugating enzyme E2-25kD, putati... 59 5e-07 >ref|XP_002511117.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis] gi|223550232|gb|EEF51719.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis] Length = 194 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 455 EMGFPEGAVRSTLEAVGGDENMALEKLCSG 366 EMGFPEG VRSTLEAV GDEN+ALEKLCSG Sbjct: 165 EMGFPEGLVRSTLEAVSGDENLALEKLCSG 194