BLASTX nr result
ID: Lithospermum22_contig00012808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00012808 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 ref|XP_002514322.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 >ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|222873229|gb|EEF10360.1| predicted protein [Populus trichocarpa] Length = 88 Score = 67.4 bits (163), Expect = 1e-09 Identities = 39/85 (45%), Positives = 45/85 (52%), Gaps = 7/85 (8%) Frame = +3 Query: 51 MCHPGVLEYPIGYRQRLP-QRRLITHAETTXXXXXXXXXXXXNRNTNGAADGGGM----- 212 MCHPGVL + R + QRRL+ A T + T AA GG Sbjct: 1 MCHPGVLS--VSQRNLVVYQRRLVLQAVETETS---------HARTEVAAGGGSAISRSI 49 Query: 213 -ECVCSPTRHPGSFRCRHHRSSYAW 284 +C+CSPTRHPGSFRCRHHRS Y W Sbjct: 50 NKCLCSPTRHPGSFRCRHHRSDYVW 74 >ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis] gi|223546778|gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 5/37 (13%) Frame = +3 Query: 189 GAADGGG-----MECVCSPTRHPGSFRCRHHRSSYAW 284 G+AD GG CVCSPTRHPGSFRCRHH YAW Sbjct: 47 GSADAGGGGGSIKMCVCSPTRHPGSFRCRHHHVDYAW 83 >ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|222865848|gb|EEF02979.1| predicted protein [Populus trichocarpa] Length = 85 Score = 57.8 bits (138), Expect = 9e-07 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +3 Query: 186 NGAADGGGMECVCSPTRHPGSFRCRHHRSSYAW 284 + A G +C+CSPTRHPGSFRCRHHRS Y W Sbjct: 42 SSAVAGSIKKCLCSPTRHPGSFRCRHHRSDYVW 74