BLASTX nr result
ID: Lithospermum22_contig00011964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00011964 (722 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554413.1| PREDICTED: cullin-3A-like [Glycine max] 96 3e-27 ref|XP_003543771.1| PREDICTED: cullin-3A-like [Glycine max] 96 3e-27 ref|XP_002283300.1| PREDICTED: cullin-3B [Vitis vinifera] gi|147... 96 5e-27 emb|CBI22194.3| unnamed protein product [Vitis vinifera] 96 5e-27 gb|AFW73414.1| hypothetical protein ZEAMMB73_078676 [Zea mays] 94 1e-26 >ref|XP_003554413.1| PREDICTED: cullin-3A-like [Glycine max] Length = 733 Score = 95.9 bits (237), Expect(2) = 3e-27 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +3 Query: 3 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNNVVAEVTKQLQSRFLPNPV 149 TRQRVEEDRKPQIEAAIVRIMKSRR LDHNN+VAEVTKQLQSRFLPNPV Sbjct: 656 TRQRVEEDRKPQIEAAIVRIMKSRRTLDHNNIVAEVTKQLQSRFLPNPV 704 Score = 52.0 bits (123), Expect(2) = 3e-27 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 247 RIESLIEREFLERDKVDRKLYRYLA 321 RIESLIEREFLERDKVDRKLYRYLA Sbjct: 709 RIESLIEREFLERDKVDRKLYRYLA 733 >ref|XP_003543771.1| PREDICTED: cullin-3A-like [Glycine max] Length = 733 Score = 95.9 bits (237), Expect(2) = 3e-27 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +3 Query: 3 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNNVVAEVTKQLQSRFLPNPV 149 TRQRVEEDRKPQIEAAIVRIMKSRR LDHNN+VAEVTKQLQSRFLPNPV Sbjct: 656 TRQRVEEDRKPQIEAAIVRIMKSRRTLDHNNIVAEVTKQLQSRFLPNPV 704 Score = 52.0 bits (123), Expect(2) = 3e-27 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 247 RIESLIEREFLERDKVDRKLYRYLA 321 RIESLIEREFLERDKVDRKLYRYLA Sbjct: 709 RIESLIEREFLERDKVDRKLYRYLA 733 >ref|XP_002283300.1| PREDICTED: cullin-3B [Vitis vinifera] gi|147833364|emb|CAN72935.1| hypothetical protein VITISV_020617 [Vitis vinifera] Length = 733 Score = 95.5 bits (236), Expect(2) = 5e-27 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 3 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNNVVAEVTKQLQSRFLPNPV 149 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNN+VAEVTKQLQSRFLP+PV Sbjct: 656 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNNIVAEVTKQLQSRFLPSPV 704 Score = 52.0 bits (123), Expect(2) = 5e-27 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 247 RIESLIEREFLERDKVDRKLYRYLA 321 RIESLIEREFLERDKVDRKLYRYLA Sbjct: 709 RIESLIEREFLERDKVDRKLYRYLA 733 >emb|CBI22194.3| unnamed protein product [Vitis vinifera] Length = 724 Score = 95.5 bits (236), Expect(2) = 5e-27 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 3 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNNVVAEVTKQLQSRFLPNPV 149 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNN+VAEVTKQLQSRFLP+PV Sbjct: 647 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNNIVAEVTKQLQSRFLPSPV 695 Score = 52.0 bits (123), Expect(2) = 5e-27 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 247 RIESLIEREFLERDKVDRKLYRYLA 321 RIESLIEREFLERDKVDRKLYRYLA Sbjct: 700 RIESLIEREFLERDKVDRKLYRYLA 724 >gb|AFW73414.1| hypothetical protein ZEAMMB73_078676 [Zea mays] Length = 736 Score = 94.4 bits (233), Expect(2) = 1e-26 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = +3 Query: 3 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNNVVAEVTKQLQSRFLPNPV 149 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHN++VAEVTKQLQ+RFLPNPV Sbjct: 659 TRQRVEEDRKPQIEAAIVRIMKSRRVLDHNSIVAEVTKQLQARFLPNPV 707 Score = 52.0 bits (123), Expect(2) = 1e-26 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 247 RIESLIEREFLERDKVDRKLYRYLA 321 RIESLIEREFLERDKVDRKLYRYLA Sbjct: 712 RIESLIEREFLERDKVDRKLYRYLA 736