BLASTX nr result
ID: Lithospermum22_contig00011853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00011853 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594071.1| S-adenosylmethionine decarboxylase proenzyme... 58 9e-07 ref|XP_004153549.1| PREDICTED: S-adenosylmethionine decarboxylas... 57 2e-06 ref|XP_004145040.1| PREDICTED: S-adenosylmethionine decarboxylas... 57 2e-06 ref|XP_003528663.1| PREDICTED: S-adenosylmethionine decarboxylas... 56 3e-06 >ref|XP_003594071.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula] gi|355483119|gb|AES64322.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula] Length = 351 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +3 Query: 3 AIEPLGMKCRSCTMDNFPIGENVVFQTFTPRRNKRVA 113 A+EPLG+KCRSC MD FP +VVFQTFTPRR K + Sbjct: 314 ALEPLGLKCRSCAMDQFPAIGSVVFQTFTPRRRKNAS 350 >ref|XP_004153549.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like [Cucumis sativus] Length = 348 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 AIEPLGMKCRSCTMDNFPIGENVVFQTFTPRRNK 104 A+EPLG+KCRSCT+D FP NVVFQTFT RR K Sbjct: 307 ALEPLGLKCRSCTVDEFPAVGNVVFQTFTTRRKK 340 >ref|XP_004145040.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like, partial [Cucumis sativus] gi|449516677|ref|XP_004165373.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like, partial [Cucumis sativus] Length = 351 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 AIEPLGMKCRSCTMDNFPIGENVVFQTFTPRRNK 104 A+EPLG+KCRSCT+D FP NVVFQTFT RR K Sbjct: 310 ALEPLGLKCRSCTVDEFPAVGNVVFQTFTTRRKK 343 >ref|XP_003528663.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like [Glycine max] Length = 346 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +3 Query: 3 AIEPLGMKCRSCTMDNFPIGENVVFQTFTPRR 98 A+EPLG+KCRSC MD FP VVFQTFTPRR Sbjct: 312 AVEPLGLKCRSCAMDKFPNAGTVVFQTFTPRR 343