BLASTX nr result
ID: Lithospermum22_contig00011033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00011033 (552 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320911.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|NP_567213.1| ribosomal RNA processing brix domain-containing... 60 2e-07 ref|XP_002437785.1| hypothetical protein SORBIDRAFT_10g002530 [S... 60 2e-07 ref|XP_002302686.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|NP_001141844.1| hypothetical protein [Zea mays] gi|194706152... 60 2e-07 >ref|XP_002320911.1| predicted protein [Populus trichocarpa] gi|222861684|gb|EEE99226.1| predicted protein [Populus trichocarpa] Length = 370 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 550 REPDGLMIIGLPDGPTAHFKMSNLVLRKDIK 458 REPDGL+IIGLPDGPTAHFK+S LVLRKDIK Sbjct: 202 REPDGLLIIGLPDGPTAHFKLSRLVLRKDIK 232 >ref|NP_567213.1| ribosomal RNA processing brix domain-containing protein [Arabidopsis thaliana] gi|7268199|emb|CAB77726.1| hypothetical protein [Arabidopsis thaliana] gi|15215626|gb|AAK91358.1| AT4g01560/F11O4_6 [Arabidopsis thaliana] gi|21554359|gb|AAM63466.1| unknown [Arabidopsis thaliana] gi|58652114|gb|AAW80882.1| At4g01560 [Arabidopsis thaliana] gi|332656642|gb|AEE82042.1| ribosomal RNA processing brix domain-containing protein [Arabidopsis thaliana] Length = 343 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 550 REPDGLMIIGLPDGPTAHFKMSNLVLRKDIK 458 REPD L+IIGLP+GPTAHFK+SNLVLRKDIK Sbjct: 188 REPDALLIIGLPNGPTAHFKLSNLVLRKDIK 218 >ref|XP_002437785.1| hypothetical protein SORBIDRAFT_10g002530 [Sorghum bicolor] gi|241916008|gb|EER89152.1| hypothetical protein SORBIDRAFT_10g002530 [Sorghum bicolor] Length = 362 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 550 REPDGLMIIGLPDGPTAHFKMSNLVLRKDIK 458 REPD L+IIGLPDGPTAHFK+S LVLRKDIK Sbjct: 195 REPDALLIIGLPDGPTAHFKLSKLVLRKDIK 225 >ref|XP_002302686.1| predicted protein [Populus trichocarpa] gi|222844412|gb|EEE81959.1| predicted protein [Populus trichocarpa] Length = 361 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 550 REPDGLMIIGLPDGPTAHFKMSNLVLRKDIK 458 REPD L+IIGLPDGPTAHFK+S LVLRKDIK Sbjct: 193 REPDALLIIGLPDGPTAHFKLSRLVLRKDIK 223 >ref|NP_001141844.1| hypothetical protein [Zea mays] gi|194706152|gb|ACF87160.1| unknown [Zea mays] gi|413950306|gb|AFW82955.1| hypothetical protein ZEAMMB73_160675 [Zea mays] Length = 360 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 550 REPDGLMIIGLPDGPTAHFKMSNLVLRKDIK 458 REPD L+IIGLPDGPTAHFK+S LVLRKDIK Sbjct: 195 REPDALLIIGLPDGPTAHFKLSKLVLRKDIK 225