BLASTX nr result
ID: Lithospermum22_contig00010490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00010490 (1391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601656.1| hypothetical protein MTR_3g084030 [Medicago ... 44 1e-07 >ref|XP_003601656.1| hypothetical protein MTR_3g084030 [Medicago truncatula] gi|355490704|gb|AES71907.1| hypothetical protein MTR_3g084030 [Medicago truncatula] Length = 749 Score = 44.3 bits (103), Expect(3) = 1e-07 Identities = 25/95 (26%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = -3 Query: 327 SVLDDATTAAKPGTSDRDNARTRELCSNTKNRSFSENKLTSAFQGQNGWSLTDNR-LVRE 151 S D + A+ + N +E+ N K E++LT NG +N L E Sbjct: 118 SAADGRGSPAQAQGLNAGNLHQKEIKQNDKKAFLFEDRLTKQHGSNNGEKARENNHLAEE 177 Query: 150 SDESKFVQELGRRIKDEGKAIGSRTIERPSSSDRR 46 + +SKF+ EL RR+++ G++ +++ +++D R Sbjct: 178 NKDSKFLMELDRRVRNNDGGAGTQLVQQSTTADCR 212 Score = 37.7 bits (86), Expect(3) = 1e-07 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 591 LVIVGYLRMSRCFPFPPPGY 532 L I G+ MSRCFPFPPPGY Sbjct: 21 LGISGFCAMSRCFPFPPPGY 40 Score = 20.4 bits (41), Expect(3) = 1e-07 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = -1 Query: 530 KRSLDQRKIYCERRNEERKSIKRRKSQKGRE 438 K ++K E++++E+K K ++GR+ Sbjct: 54 KERRKEKKHKKEKKDKEKKESKENGEKEGRD 84