BLASTX nr result
ID: Lithospermum22_contig00009882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00009882 (472 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABE02823.1| GRAS1 [Nicotiana tabacum] 55 6e-06 >gb|ABE02823.1| GRAS1 [Nicotiana tabacum] Length = 644 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -3 Query: 122 MIKFIGDTLMDEEDLSHIPCMYYDCMALQATEKSFHDAL 6 M K+I LM+EEDL + PCM++DCMALQA EK F D L Sbjct: 81 MYKYISQMLMEEEDLEYKPCMFHDCMALQAAEKYFSDVL 119