BLASTX nr result
ID: Lithospermum22_contig00009540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00009540 (526 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK43840.1|AF370463_1 S18.A ribosomal protein [Arabidopsis th... 60 2e-07 ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana... 60 2e-07 ref|XP_002307515.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|XP_003592049.1| 40S ribosomal protein S18 [Medicago truncatu... 59 3e-07 gb|AFK43302.1| unknown [Lotus japonicus] 58 7e-07 >gb|AAK43840.1|AF370463_1 S18.A ribosomal protein [Arabidopsis thaliana] gi|17978783|gb|AAL47385.1| S18.A ribosomal protein [Arabidopsis thaliana] Length = 152 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 91 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 2 RAGELSAAEIDN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAEIDNLMTIVANPRQFKIPDWFL 84 >ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|15234790|ref|NP_192718.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|18399100|ref|NP_564434.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|297809155|ref|XP_002872461.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297845304|ref|XP_002890533.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297851838|ref|XP_002893800.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|464707|sp|P34788.1|RS18_ARATH RecName: Full=40S ribosomal protein S18 gi|10086474|gb|AAG12534.1|AC015446_15 ribosomal protein S18 [Arabidopsis thaliana] gi|10092450|gb|AAG12853.1|AC079286_10 40S ribosomal protein S18; 25853-24673 [Arabidopsis thaliana] gi|14423408|gb|AAK62386.1|AF386941_1 S18.A ribosomal protein [Arabidopsis thaliana] gi|15724158|gb|AAL06471.1|AF411781_1 At1g22780/T22J18_5 [Arabidopsis thaliana] gi|405613|emb|CAA80684.1| ribosomal protein S18A [Arabidopsis thaliana] gi|434343|emb|CAA82273.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434345|emb|CAA82274.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434906|emb|CAA82275.1| S18 ribosomal protein [Arabidopsis thaliana] gi|2505871|emb|CAA72909.1| ribosomal protein S18A [Arabidopsis thaliana] gi|3287678|gb|AAC25506.1| Match to ribosomal S18 gene mRNA gb|Z28701, DNA gb|Z23165 from A. thaliana. ESTs gb|T21121, gb|Z17755, gb|R64776 and gb|R30430 come from this gene [Arabidopsis thaliana] gi|4538910|emb|CAB39647.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|7267675|emb|CAB78103.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|14334584|gb|AAK59471.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|17979113|gb|AAL47500.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|21555397|gb|AAM63849.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21592452|gb|AAM64403.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21593027|gb|AAM64976.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|30102858|gb|AAP21347.1| At4g09800 [Arabidopsis thaliana] gi|56236126|gb|AAV84519.1| At1g22780 [Arabidopsis thaliana] gi|98961089|gb|ABF59028.1| At1g22780 [Arabidopsis thaliana] gi|145713244|gb|ABP96570.1| pointed first leaf [Arabidopsis thaliana] gi|145713246|gb|ABP96571.1| pointed first leaf [Arabidopsis thaliana] gi|145713248|gb|ABP96572.1| pointed first leaf [Arabidopsis thaliana] gi|145713250|gb|ABP96573.1| pointed first leaf [Arabidopsis thaliana] gi|145713252|gb|ABP96574.1| pointed first leaf [Arabidopsis thaliana] gi|145713254|gb|ABP96575.1| pointed first leaf [Arabidopsis thaliana] gi|145713256|gb|ABP96576.1| pointed first leaf [Arabidopsis thaliana] gi|145713258|gb|ABP96577.1| pointed first leaf [Arabidopsis thaliana] gi|145713260|gb|ABP96578.1| pointed first leaf [Arabidopsis thaliana] gi|145713262|gb|ABP96579.1| pointed first leaf [Arabidopsis thaliana] gi|145713264|gb|ABP96580.1| pointed first leaf [Arabidopsis thaliana] gi|145713266|gb|ABP96581.1| pointed first leaf [Arabidopsis thaliana] gi|145713268|gb|ABP96582.1| pointed first leaf [Arabidopsis thaliana] gi|145713270|gb|ABP96583.1| pointed first leaf [Arabidopsis thaliana] gi|145713272|gb|ABP96584.1| pointed first leaf [Arabidopsis thaliana] gi|145713274|gb|ABP96585.1| pointed first leaf [Arabidopsis thaliana] gi|145713276|gb|ABP96586.1| pointed first leaf [Arabidopsis thaliana] gi|145713278|gb|ABP96587.1| pointed first leaf [Arabidopsis thaliana] gi|145713280|gb|ABP96588.1| pointed first leaf [Arabidopsis thaliana] gi|145713282|gb|ABP96589.1| pointed first leaf [Arabidopsis thaliana] gi|145713284|gb|ABP96590.1| pointed first leaf [Arabidopsis thaliana] gi|297318298|gb|EFH48720.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297336375|gb|EFH66792.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297339642|gb|EFH70059.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|332192166|gb|AEE30287.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332193538|gb|AEE31659.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332657400|gb|AEE82800.1| 40S ribosomal protein S18 [Arabidopsis thaliana] Length = 152 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 91 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 2 RAGELSAAEIDN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAEIDNLMTIVANPRQFKIPDWFL 84 >ref|XP_002307515.1| predicted protein [Populus trichocarpa] gi|222856964|gb|EEE94511.1| predicted protein [Populus trichocarpa] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 91 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 2 RAGELSAAE+DN+MTIV NPRQF IPDWFL Sbjct: 55 RAGELSAAELDNLMTIVANPRQFKIPDWFL 84 >ref|XP_003592049.1| 40S ribosomal protein S18 [Medicago truncatula] gi|357443553|ref|XP_003592054.1| 40S ribosomal protein S18 [Medicago truncatula] gi|217075242|gb|ACJ85981.1| unknown [Medicago truncatula] gi|355481097|gb|AES62300.1| 40S ribosomal protein S18 [Medicago truncatula] gi|355481102|gb|AES62305.1| 40S ribosomal protein S18 [Medicago truncatula] gi|388517109|gb|AFK46616.1| unknown [Medicago truncatula] Length = 152 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 91 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 2 RAGELSAAE+DNIMT+V NPRQF +PDWFL Sbjct: 55 RAGELSAAELDNIMTVVANPRQFKVPDWFL 84 >gb|AFK43302.1| unknown [Lotus japonicus] Length = 152 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 91 RAGELSAAEIDNIMTIVGNPRQFNIPDWFL 2 RAGELSAAE+DN+MT+V NP+QF IPDWFL Sbjct: 55 RAGELSAAELDNVMTVVANPKQFKIPDWFL 84