BLASTX nr result
ID: Lithospermum22_contig00009069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00009069 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB45854.1| hypothetical protein [Eutrema halophilum] 57 2e-06 >gb|ABB45854.1| hypothetical protein [Eutrema halophilum] Length = 419 Score = 56.6 bits (135), Expect = 2e-06 Identities = 33/74 (44%), Positives = 45/74 (60%) Frame = +1 Query: 4 SYSFVSTQGEFFDAIEDFXXXXXXXXXQLRVHCIESETRAMSLSLLEQIERRKTAEDTLK 183 S+ S+ GEF+DA ++ Q V+ IESE R M LSLL +IERR+ AE+TL+ Sbjct: 206 SHKLFSSGGEFYDARDELSTDSGT---QSSVNHIESELRGMRLSLLMEIERRRQAEETLE 262 Query: 184 LMQNQWQRISNLLA 225 MQ W+R+ LA Sbjct: 263 KMQLHWRRLREQLA 276