BLASTX nr result
ID: Lithospermum22_contig00008984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00008984 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADY38787.1| ethylene receptor [Coffea arabica] 60 1e-07 gb|ADI44158.1| ethylene receptor [Coffea canephora] 60 1e-07 gb|ABZ89180.1| ethylene receptor [Coffea canephora] gi|326367380... 60 1e-07 >gb|ADY38787.1| ethylene receptor [Coffea arabica] Length = 765 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +1 Query: 211 MVGMLKLLILGSFVAFIVISASA-DEIYSHCSCDDEGGWSLASILECQRVS 360 M L+ +LG VA ++ S SA D +SHC CDD GGWS+ASILECQRVS Sbjct: 1 MGSRLRDFVLGLLVAVMIFSVSATDGEFSHCHCDDVGGWSIASILECQRVS 51 >gb|ADI44158.1| ethylene receptor [Coffea canephora] Length = 765 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +1 Query: 211 MVGMLKLLILGSFVAFIVISASA-DEIYSHCSCDDEGGWSLASILECQRVS 360 M L+ +LG VA ++ S SA D +SHC CDD GGWS+ASILECQRVS Sbjct: 1 MGSRLRDFVLGLLVAVMIFSVSATDGEFSHCHCDDVGGWSIASILECQRVS 51 >gb|ABZ89180.1| ethylene receptor [Coffea canephora] gi|326367380|gb|ADZ55298.1| ethylene receptor [Coffea arabica] Length = 765 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = +1 Query: 211 MVGMLKLLILGSFVAFIVISASA-DEIYSHCSCDDEGGWSLASILECQRVS 360 M L+ +LG VA ++ S SA D +SHC CDD GGWS+ASILECQRVS Sbjct: 1 MGSRLRDFVLGLLVAVMIFSVSATDGEFSHCHCDDVGGWSIASILECQRVS 51