BLASTX nr result
ID: Lithospermum22_contig00008980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00008980 (618 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509790.1| glutathione peroxidase, putative [Ricinus co... 82 1e-13 gb|ABQ96599.1| glutathione peroxidase [Ricinus communis] 82 1e-13 gb|AAL55674.1| glutathione peroxidase [Hevea brasiliensis] 82 1e-13 emb|CAJ43709.1| glutathion peroxidase [Plantago major] 81 2e-13 gb|ACV52584.1| phospholipid hydroperoxide glutathione peroxidase... 80 2e-13 >ref|XP_002509790.1| glutathione peroxidase, putative [Ricinus communis] gi|223549689|gb|EEF51177.1| glutathione peroxidase, putative [Ricinus communis] Length = 168 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 498 IVNVASQCGLTNSNYTELTKLYENYKDQGLEILAFPCNQF 617 IVNVASQCGLTNSNYTELT+LY+ YKDQGLEILAFPCNQF Sbjct: 35 IVNVASQCGLTNSNYTELTQLYQKYKDQGLEILAFPCNQF 74 >gb|ABQ96599.1| glutathione peroxidase [Ricinus communis] Length = 173 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 498 IVNVASQCGLTNSNYTELTKLYENYKDQGLEILAFPCNQF 617 IVNVASQCGLTNSNYTELT+LY+ YKDQGLEILAFPCNQF Sbjct: 32 IVNVASQCGLTNSNYTELTQLYQKYKDQGLEILAFPCNQF 71 >gb|AAL55674.1| glutathione peroxidase [Hevea brasiliensis] Length = 176 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 498 IVNVASQCGLTNSNYTELTKLYENYKDQGLEILAFPCNQF 617 IVNVASQCGLTNSNYTELT+LY+ YKDQGLEILAFPCNQF Sbjct: 35 IVNVASQCGLTNSNYTELTQLYQKYKDQGLEILAFPCNQF 74 >emb|CAJ43709.1| glutathion peroxidase [Plantago major] Length = 168 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +3 Query: 498 IVNVASQCGLTNSNYTELTKLYENYKDQGLEILAFPCNQF 617 IVNVASQCGLTNSNYTELT LY+ YKDQGLEILAFPCNQF Sbjct: 35 IVNVASQCGLTNSNYTELTTLYQKYKDQGLEILAFPCNQF 74 >gb|ACV52584.1| phospholipid hydroperoxide glutathione peroxidase [Nicotiana benthamiana] Length = 146 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 498 IVNVASQCGLTNSNYTELTKLYENYKDQGLEILAFPCNQF 617 IVNVASQCGLTNSNYTELT++Y+ YKDQGLEILAFPCNQF Sbjct: 24 IVNVASQCGLTNSNYTELTEIYKKYKDQGLEILAFPCNQF 63